Msep009464.1
Basic Information
- Insect
- Mythimna separata
- Gene Symbol
- -
- Assembly
- GCA_030763345.1
- Location
- CM061174.1:12152982-12170076[+]
Transcription Factor Domain
- TF Family
- AF-4
- Domain
- AF-4 domain
- PFAM
- PF05110
- TF Group
- Unclassified Structure
- Description
- This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X syndrome) nuclear proteins. These proteins have been linked to human diseases such as acute lymphoblastic leukaemia and mental disabilities [1]. The family also contains a Drosophila AF4 protein homologue Lilliputian which contains an AT-hook domain. Lilliputian represents a novel pair-rule gene that acts in cytoskeleton regulation, segmentation and morphogenesis in Drosophila [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.3e-12 4.9e-08 33.7 0.0 4 76 33 107 31 115 0.86
Sequence Information
- Coding Sequence
- ATGGAGGCGGTCGGTTCTCGGTACGACAAGTGGGACCGGGACAGGGGCGGGGGGAgcggcggcgggggcggcggGGCCGGCGCGTGGGCCGGGCGCGACCGCGAGcgcgaccgcgagcgcgagcgGAAGGCGCGCGCGCACCAGATGTCGCAGGCGCACGCCGCCGAGCCCGACGCATCGTCGCTCTTCCCGGCGCCGTTCAGGGTGACAGGCAGGCAGGATCGCGTGAGCCAGCAGATCCAGACCAAGCTTGGCGACTACCACCTCGCGCAGTGGTTCATTGACGACCCCAGCAAATCCATTGGGATTTGCGCTGAACCACCTAGTCCTGCACCATGTTGCACGTGA
- Protein Sequence
- MEAVGSRYDKWDRDRGGGSGGGGGGAGAWAGRDRERDRERERKARAHQMSQAHAAEPDASSLFPAPFRVTGRQDRVSQQIQTKLGDYHLAQWFIDDPSKSIGICAEPPSPAPCCT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00124285; iTF_00040831; iTF_01029281; iTF_01085251; iTF_01526033; iTF_00284554; iTF_00771940; iTF_01230598; iTF_00851815; iTF_00951848; iTF_00155308; iTF_00409292; iTF_00660327; iTF_00658410; iTF_00411471; iTF_00772890;
- 90% Identity
- iTF_01061904;
- 80% Identity
- -