Mdol017194.1
Basic Information
- Insect
- Megamerina dolium
- Gene Symbol
- Runx1_1
- Assembly
- GCA_963854835.1
- Location
- OY978527.1:66613615-66614187[-]
Transcription Factor Domain
- TF Family
- Runt
- Domain
- Runt domain
- PFAM
- PF00853
- TF Group
- Beta-Scaffold Factors
- Description
- The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 4 3.4e+04 -8.7 7.5 60 64 31 35 7 54 0.57 2 2 1.3e-52 1.1e-48 165.0 0.0 3 95 95 187 93 189 0.97
Sequence Information
- Coding Sequence
- ATGCATCtcacaacaacgacgacaaatTCCTCAGCCACAAGTAATAATGCGACCTCGGCATCgaataatagcaacagcaacaacaacaacaacaataacaatagcagcagcaacaacaacaacaacaatgtcagTTCGAATtcgaacaataataacagcTCCACAAACGGTTCGAATACAAATGGTAGCAATGAACAGAATACACCACCAACAGCAGCACAACTCCTTAATGAGGCCTACACCAAAATGACTTCAGATATTTTAGCCGAACGTACATTAGGTGATTTTCTCACTGAACACCCTGGCGAACTGATACGTACAAGTAGTCCACTTTTTGTCTGCACCGTATTGCCACCACATTGGCGTTCGAATAAAACATTACCGGTCGCCTTTAAAGTTGTCTCACTCGGTGATATTATGGATGGTACTATGGTGACGGTGCGAGCTGGTAACGATGAGAATTATTGTGCGGAATTGCGTAATTGTACGGCGGTGATGAAGAATCAAGTGGCGAAATTTAATGATCTGCGTTTTGTCGGACGAAGTGGTCGAGGTGAGTACCTTAGTGGGTaa
- Protein Sequence
- MHLTTTTTNSSATSNNATSASNNSNSNNNNNNNNSSSNNNNNNVSSNSNNNNSSTNGSNTNGSNEQNTPPTAAQLLNEAYTKMTSDILAERTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENYCAELRNCTAVMKNQVAKFNDLRFVGRSGRGEYLSG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00601537; iTF_00061701; iTF_00816325; iTF_00899301; iTF_01231367; iTF_01312811; iTF_00080972; iTF_00817199; iTF_01195791; iTF_00747249; iTF_00082706; iTF_00080970; iTF_00336498; iTF_00189715; iTF_00062518; iTF_00060879; iTF_00748758; iTF_00257591; iTF_00747991; iTF_01045245; iTF_00090942; iTF_00370750; iTF_01236432; iTF_00716408; iTF_01374750; iTF_00081919;
- 90% Identity
- -
- 80% Identity
- -