Basic Information

Transcription Factor Domain

TF Family: Runt
Domain: Runt domain
PFAM: PF00853
TF Group: Beta-Scaffold Factors
Description: The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 4 1.4e+04 -5.6 3.9 59 67 23 31 12 50 0.51

2 3 4 1.4e+04 -5.3 4.3 57 71 43 57 31 65 0.65

3 3 6.5e-51 2.2e-47 159.5 0.0 3 92 91 180 89 180 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	4	1.4e+04	-5.6	3.9	59	67	23	31	12	50	0.51
2	3	4	1.4e+04	-5.3	4.3	57	71	43	57	31	65	0.65
3	3	6.5e-51	2.2e-47	159.5	0.0	3	92	91	180	89	180	0.98

Coding Sequence: ATGCATCTCACAGCGACTACAAATGGAGGAGGCACggccaataataataatacggCCGCCtccagcaataacaacaacaattccaACACccagaataacaacaacaacacaagttCGAGCAATTCCAatggcaacaataacaacaacagttcaaatggcaacaacaacaacaattcaagCGAACAAAATACTCCGCCCACAGCAGCCCAACTGCTGAATGAGGCCTATACGAAAATGACTTCGGACATATTGGCCGAACGTACACTCGGCGATTTTCTCACCGAACATCCGGGTGAATTGATCCGCACCAGTAGTCCGTTGTTCGTCTGCACCGTATTGCCGCCGCATTGGCGTTCGAATAAAACATTGCCGGTGGCCTTTAAGGTTGTGTCGCTGGGCGACATCATGGATGGCACAATGGTAACGGTGCGAGCGGGCAACGATGAGAACTATTGTGCCGAACTGAGAAATTCGACGGCAGTGATGAAGAATCAGGTGGCGAAATTCAATGATTTACGATTTGTGGGGCGAAGTGGTAGAG
Protein Sequence: MHLTATTNGGGTANNNNTAASSNNNNNSNTQNNNNNTSSSNSNGNNNNNSSNGNNNNNSSEQNTPPTAAQLLNEAYTKMTSDILAERTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENYCAELRNSTAVMKNQVAKFNDLRFVGRSGR

Sequence clustering based on sequence similarity using MMseqs2