Ltes046462.1
Basic Information
- Insect
- Linnaemya tessellans
- Gene Symbol
- Runx1
- Assembly
- GCA_951800035.1
- Location
- OX637536.1:9154080-9155361[+]
Transcription Factor Domain
- TF Family
- Runt
- Domain
- Runt domain
- PFAM
- PF00853
- TF Group
- Beta-Scaffold Factors
- Description
- The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 4 6.4e+04 -8.1 6.9 54 71 17 34 7 53 0.60 2 2 2.5e-52 4.1e-48 164.0 0.0 3 96 85 178 83 193 0.96
Sequence Information
- Coding Sequence
- ATGCATCTCACCACTACAACAACAAATGGCACGGCCAATACCAACAATACGGCCACagccaataataataacaacaacaataataatagccAGAATAACAACAGTTCAGCAAACACAAACTCCAATAACAATTCATCgaatggcaacaacaacaatagcactGAACAAAATACTCCGCCCACAGCAGCCCAACTACTCAATGAGGCCTACACCAAAATGACTTCGGACATTTTGGCCGAACGTACACTTGGCGATTTTCTTACCGAACATCCGGGCGAGCTGATACGCACCAGCAGTCCGTTGTTTGTTTGCACAGTTTTACCGCCGCATTGGCGTTCGAACAAAACGCTGCCGGTGGCATTTAAAGTTGTTTCGTTGGGCGACATTATGGATGGCACCATGGTGACGGTGCGAGCGGGCAATGATGAAAACTATTGTGCTGAATTGAGAAATTCAACGGCGGTGATGAAGAATCAAGTGGCCAAATTTAATGATCTACGTTTTGTGGGACGCAGTGGTAGAGGCCATGAGCATACGGATGTGCCGACTTCGCCAGCAAACTTCTCTAATAGTGATTCGAAGATTCTCCATAAACATTTTCCTTATTTTGTCAAGCTTTAA
- Protein Sequence
- MHLTTTTTNGTANTNNTATANNNNNNNNNSQNNNSSANTNSNNNSSNGNNNNSTEQNTPPTAAQLLNEAYTKMTSDILAERTLGDFLTEHPGELIRTSSPLFVCTVLPPHWRSNKTLPVAFKVVSLGDIMDGTMVTVRAGNDENYCAELRNSTAVMKNQVAKFNDLRFVGRSGRGHEHTDVPTSPANFSNSDSKILHKHFPYFVKL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00966938;
- 90% Identity
- -
- 80% Identity
- -