Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0044 40 5.7 0.0 27 52 2 27 1 29 0.91

2 4 1.8e-07 0.0016 19.8 0.0 22 46 31 55 26 60 0.87

3 4 0.0021 19 6.8 0.3 21 48 60 87 57 92 0.92

4 4 0.47 4.2e+03 -0.8 0.1 21 44 89 112 86 120 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0044	40	5.7	0.0	27	52	2	27	1	29	0.91
2	4	1.8e-07	0.0016	19.8	0.0	22	46	31	55	26	60	0.87
3	4	0.0021	19	6.8	0.3	21	48	60	87	57	92	0.92
4	4	0.47	4.2e+03	-0.8	0.1	21	44	89	112	86	120	0.72

Coding Sequence: ATGTGTGATATTTGCGGAAATACGTTTAAAAGTAAATTCACACTGAAAAAACACATTGAGTATCAACACTCGGGAAACCCACGCAAAGATAAAGAACCACAACAGTGTCCTATTTGTTACAAAGTCTTAAAAGGCAATAAAGGTCTTAGGGCGCACATGAATAATATTCACGATGACGGCGAACAGGAGCATCGCTGTAAGGTCTGTAATCACGTTTCGACAACGGCCAAAGGTTTACGTGTACATGAGATATTCCGCCATGAAAAAGAGAGGAAACATAAGTGTTCTTTGTGTGACAAAGCATTTAAGAGGCCTTTGGacttgaaaGAGCACATGGCAACACACACAGGCGAGCCGTTGTATACGTGCGTGAATTGTGGGAAAACATTTAAGTCTAAAGCAAATATGTTTCACCATCGAAGGCGTTTTCACCGGGCCGAATGGATAGCTGATCGCACTAAACCGCCTAAAGAGAAATATTCcagaaattga
Protein Sequence: MCDICGNTFKSKFTLKKHIEYQHSGNPRKDKEPQQCPICYKVLKGNKGLRAHMNNIHDDGEQEHRCKVCNHVSTTAKGLRVHEIFRHEKERKHKCSLCDKAFKRPLDLKEHMATHTGEPLYTCVNCGKTFKSKANMFHHRRRFHRAEWIADRTKPPKEKYSRN

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00655751; iTF_00742249; iTF_01261371; iTF_01261552; iTF_01237182; iTF_01237315;
90% Identity: iTF_00655751;
80% Identity: iTF_00742249;