Pgri048601.1
Basic Information
- Insect
- Pollenia griseotomentosa
- Gene Symbol
- Hivep2
- Assembly
- GCA_963931875.1
- Location
- OZ007564.1:34630059-34632005[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.0071 91 5.1 0.0 27 52 2 27 1 29 0.90 2 4 3.2e-08 0.00041 22.2 0.1 21 45 30 54 24 58 0.85 3 4 0.00078 10 8.1 0.4 20 48 59 87 55 90 0.93 4 4 0.022 2.9e+02 3.5 0.1 19 43 87 111 85 119 0.82
Sequence Information
- Coding Sequence
- ATGTGCGATATATGTGGCaatacgtttaaaacaaaattcacttTAAAGAAACACATTGAATATCATCATTCGGAGAATCCACGTAAAGACAAAGATCCCCAGTCATGTCCCATTTGTTACAAAGTGCTGAGAGGCCACAAGGGTCTAAGGGCCCATATGAAAAATATACATGACGACAGTGAACAGGAGCACCGTTGTAAAATTTGTAATCACCTCTCGACAACAGCTAAAGGTTTGCGAGTCCACGAGATATTTCGCCACGAAAAGGAGAGAAAACACAAGTGTTCTTTGTGTTACAAAGCATTTAAGAGGCCATTGGAtttgaaaGAACATACGGCCACCCATACGGGCGAGCCTTTGTACGCTTGTGCAAATTGCGGCCAAACATTTAAGTCTAAAGCAAATATGTTTCATCATCGTAGACGTTTTCATCGACCCGAATGGACAGCTGATCGCACAAAACcaccaaaagaaaaatattcaagaaactaa
- Protein Sequence
- MCDICGNTFKTKFTLKKHIEYHHSENPRKDKDPQSCPICYKVLRGHKGLRAHMKNIHDDSEQEHRCKICNHLSTTAKGLRVHEIFRHEKERKHKCSLCYKAFKRPLDLKEHTATHTGEPLYACANCGQTFKSKANMFHHRRRFHRPEWTADRTKPPKEKYSRN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00742432;
- 90% Identity
- iTF_01237182;
- 80% Identity
- iTF_01237182;