Aepo022587.3
Basic Information
- Insect
- Apamea epomidion
- Gene Symbol
- -
- Assembly
- GCA_947507525.1
- Location
- OX382254.1:6256595-6259210[-]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 19 0.22 16 6.6 0.6 1 23 52 75 52 75 0.94 2 19 0.0014 0.098 13.5 0.3 2 23 102 124 101 124 0.95 3 19 0.029 2.1 9.4 1.7 2 23 147 168 146 168 0.97 4 19 0.08 5.7 8.0 0.4 1 23 172 194 172 194 0.96 5 19 0.17 12 7.0 1.6 1 23 199 222 199 222 0.97 6 19 0.027 1.9 9.5 2.1 1 23 228 251 228 251 0.95 7 19 0.0011 0.082 13.8 1.5 2 23 259 281 258 281 0.96 8 19 3.1e-06 0.00022 21.9 1.5 1 23 287 309 287 309 0.96 9 19 0.00022 0.016 16.0 0.9 1 23 315 337 315 337 0.99 10 19 2.4 1.7e+02 3.4 0.2 3 23 413 434 411 434 0.89 11 19 0.014 1 10.3 0.2 2 23 460 482 459 482 0.93 12 19 0.00065 0.046 14.6 0.3 2 23 505 526 504 526 0.97 13 19 0.0011 0.079 13.8 0.0 1 23 530 552 530 552 0.98 14 19 1.6e-05 0.0011 19.7 1.9 1 23 557 580 557 580 0.98 15 19 0.21 15 6.7 0.4 2 23 588 610 587 610 0.94 16 19 0.00015 0.011 16.6 2.3 2 23 618 640 617 640 0.96 17 19 5.2e-05 0.0037 18.0 1.8 1 23 646 668 646 668 0.98 18 19 1.5e-05 0.0011 19.7 1.0 1 23 674 696 674 696 0.99 19 19 6.4e-05 0.0045 17.7 2.4 1 23 702 725 702 725 0.97
Sequence Information
- Coding Sequence
- ATGAGTGTAGCAAACCCTAAAGCAACAGGATCGTCCAAACCTCCTATAGTGTCTAAAGGATATAGTGCTGAAATTAACAGGCATAAAACGAATATTATAGAAataatgcgttggtccaacgctacaccaataaaactttggggagatatgggttacatgtgttgttactgtgaagaccaatacatagagccggcagatctcaagagacacactctacaagcccatgagaacgttaccaaagcctacttcataaaaaacatgagcatgtacaattacatcatcaaattagacatcactgatttgcagtgcaagatatgtaataaaagtatcgacactactgaagagttaatggatcacttgaagaatgaacacaagaaaaatatacatactgacatcaacaaccacatagtcccttttaagtttaacacaaaggctctcgaatgtttcatttgcaaaaatgttttccacaaattcaaattattagtgatacatatgaatatgcactataggaactatatatgtgatatctgtgatgccgggtacgtaaactactgtaggcttaagctccataaagcgatacacaacactgaaaacttcaactgttcgtcttgttcgatgaagttcgaaactttggctcagagaaacctgcatgtgaagactaagcataccaaaattgttcgtcacaaatgtggttactgtaaggaaagattcaacgattataggaagaaggaagctcatctgatatctgttcatggacagagtcaacaaaagtcgaaatgccaagcgtgtgataaagaatttgatcaccggaaacaattagccgtgcacgttaaaagagaccatttgatggtaagaccacacgcttgtgaagtgtgtgagaagacatttttcactccgagtgagctgagaaatcatatgagcaagcattcaggggagaagccttataaatgtgaaatttgtttcaagtcttatggacagtcgaggatcttaaaagaacatatgaggattcataacgatgataagcGTCACGGACGAGGAACTAGAATAATCAAAATAGAAAAACCGACAAAAGCAACCGTTGAATTGAAGTTCATCTCAAAACTAACAACGAGAGACCCAAATGCCATCCTAAAAGGCTCCATATCAGAAACTGTGAAGAACAAAATgaatctaaaaaatatattgctcaactctaacgcaaacccaataagatgtaaagatggtcatggatatggctgttcgttctgtccaaaacagtatcttgagccgactgctctcaagaagcactttctagaagaacataacaatgacaaactgataaagtacatgactgctaagctatttgatcatgtcattaagctagatataacgtacttgaattgtgctctttgtgacaaagacgtcaaacatttggacgacctcgtagcacatctgaaggacgaacataacaagtcgatgtatctagacgctaaaagccaaatcgtcccgttcagattcgactcgcccgaactaaaatgtgtcatatgctctgcagaattcagttcattcaaacttttacaagaacacatgaattcacatttcggtaattatatttgtgaaatatgtggagcagggtttgtgactgacagactcctagttagccacgtcaaacggcatgatagcggagagtataaatgtgatcaatgtgataaaacttttacaaaccaaattaaaatacgcgagcacattaaacgaacacatctaggacagagcaagaggaacaaatgcaattactgcgcggaaagattcgtcgattactggaaaaagatggatcatatggtaaaagagcatggaatgccccctgtcgttctcaaatgtaccgcttgtgagcgaacttttagcaaccaacggtctttatcacggcacacgaagaaagatcaccttttggagagaaggcacaagtgtggcgaatgtgatatgagattctttggaaaaagtggtttgcaaaaacacatggccaagcacacggggctgaggcagttcagatgtgaagtttgcttaaagtcttatggaaggaagaatacgctaagagagcatatgaggatccatgcgaatgacagaagattcgcttgcactcaatgtggccaagcgttcgtccaaaagtgtagctggcggagtcatatgcgctcaaaacatggagaagaagtgtag
- Protein Sequence
- MSVANPKATGSSKPPIVSKGYSAEINRHKTNIIEIMRWSNATPIKLWGDMGYMCCYCEDQYIEPADLKRHTLQAHENVTKAYFIKNMSMYNYIIKLDITDLQCKICNKSIDTTEELMDHLKNEHKKNIHTDINNHIVPFKFNTKALECFICKNVFHKFKLLVIHMNMHYRNYICDICDAGYVNYCRLKLHKAIHNTENFNCSSCSMKFETLAQRNLHVKTKHTKIVRHKCGYCKERFNDYRKKEAHLISVHGQSQQKSKCQACDKEFDHRKQLAVHVKRDHLMVRPHACEVCEKTFFTPSELRNHMSKHSGEKPYKCEICFKSYGQSRILKEHMRIHNDDKRHGRGTRIIKIEKPTKATVELKFISKLTTRDPNAILKGSISETVKNKMNLKNILLNSNANPIRCKDGHGYGCSFCPKQYLEPTALKKHFLEEHNNDKLIKYMTAKLFDHVIKLDITYLNCALCDKDVKHLDDLVAHLKDEHNKSMYLDAKSQIVPFRFDSPELKCVICSAEFSSFKLLQEHMNSHFGNYICEICGAGFVTDRLLVSHVKRHDSGEYKCDQCDKTFTNQIKIREHIKRTHLGQSKRNKCNYCAERFVDYWKKMDHMVKEHGMPPVVLKCTACERTFSNQRSLSRHTKKDHLLERRHKCGECDMRFFGKSGLQKHMAKHTGLRQFRCEVCLKSYGRKNTLREHMRIHANDRRFACTQCGQAFVQKCSWRSHMRSKHGEEV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00121674; iTF_00173453; iTF_00037097; iTF_01526325; iTF_00906395;
- 90% Identity
- iTF_00121674;
- 80% Identity
- -