Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.056 1.5e+02 2.7 0.0 23 49 18 44 14 47 0.84

2 7 0.00014 0.37 11.0 0.0 21 52 44 75 42 76 0.88

3 7 0.062 1.7e+02 2.5 0.0 21 44 72 95 70 99 0.86

4 7 0.00085 2.3 8.5 0.1 21 46 100 125 95 133 0.90

5 7 0.019 51 4.2 0.0 23 49 134 160 127 163 0.86

6 7 0.00082 2.2 8.5 0.0 21 51 160 190 158 191 0.88

7 7 0.00084 2.3 8.5 0.1 21 46 188 213 186 223 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.056	1.5e+02	2.7	0.0	23	49	18	44	14	47	0.84
2	7	0.00014	0.37	11.0	0.0	21	52	44	75	42	76	0.88
3	7	0.062	1.7e+02	2.5	0.0	21	44	72	95	70	99	0.86
4	7	0.00085	2.3	8.5	0.1	21	46	100	125	95	133	0.90
5	7	0.019	51	4.2	0.0	23	49	134	160	127	163	0.86
6	7	0.00082	2.2	8.5	0.0	21	51	160	190	158	191	0.88
7	7	0.00084	2.3	8.5	0.1	21	46	188	213	186	223	0.88

Coding Sequence: ATGTCACAgcaggaagtggaaagtgCTGGCATGAAAATTCCGAACTGCTCCAAACCGTTCGAGTGTACAGAATGCAACAAATTGTTCCGGCAGCTCAGCACGCTGACCAACCACATGAAGATTCACACCGGGGAAAAACCGTACAAGTGTACCATTTGCCAGAAAGAATTTCGCCAAACGACCACGCTTTCAAATCATCTGAAGATCCATACAGGCGAAAAGCCGTTCAGCTGCAGCTTTTGCGATAAACAGTTCCGTCAGCTAAGCACCCTTTCGAACCATCAGAAAATACACACCGGCGAAAAGCCGTTCGAATGTTCCGTCTGTGGCAAACAGTTCCGACAGTCCAGTACGCTCAACAGTCATATCAGGATCCATTCGGACGATAAATTTTGCATCAAACCGTTCAAATGCAGCGTTTGTCCGAAGGAATTCCGCCAGACGACGACTCTTGCGAATCATATAAAAATTCACACAGGTGAAAAGCCGTACGCCTGCACGTACTGCAACAAAACGTTTCGTCAGACAGGAACGCTTTCGAACCATCTGAAAATCCACACAGGCGAGAAACCGTTCGAGTGCGCCGTGTGCGGCAAACAGTTTCGCCAGTCCAGCACCTTGAACAGTCACATTCGTATTCATGCTGACGACAATTATTGCAAACCAACTACAACAACTATTAGCACAACGGTCAACGATGAACTTATAAAGGTTGAGGACATCAAACCGTTTTATTCGACAATGTAA
Protein Sequence: MSQQEVESAGMKIPNCSKPFECTECNKLFRQLSTLTNHMKIHTGEKPYKCTICQKEFRQTTTLSNHLKIHTGEKPFSCSFCDKQFRQLSTLSNHQKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHSDDKFCIKPFKCSVCPKEFRQTTTLANHIKIHTGEKPYACTYCNKTFRQTGTLSNHLKIHTGEKPFECAVCGKQFRQSSTLNSHIRIHADDNYCKPTTTTISTTVNDELIKVEDIKPFYSTM

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01462352;
90% Identity: iTF_00105958; iTF_00109281; iTF_00107812; iTF_00096518; iTF_00108045; iTF_00109296; iTF_00107826; iTF_00096532; iTF_00109499; iTF_00096734; iTF_00097223; iTF_00097451; iTF_00097210; iTF_00092935; iTF_00092304; iTF_00092533; iTF_00092951; iTF_00093150;
80% Identity: iTF_00105958;