Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.035 91 3.1 0.0 22 49 17 44 5 47 0.84

2 7 0.00014 0.35 10.8 0.0 21 52 44 75 41 77 0.89

3 7 0.1 2.6e+02 1.6 0.0 21 44 72 95 70 99 0.86

4 7 0.00082 2.1 8.3 0.1 21 46 100 125 98 133 0.90

5 7 0.0058 15 5.6 0.1 23 49 134 160 131 163 0.86

6 7 0.00064 1.7 8.7 0.0 21 52 160 191 156 192 0.89

7 7 0.00061 1.6 8.7 0.1 21 46 188 213 184 223 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.035	91	3.1	0.0	22	49	17	44	5	47	0.84
2	7	0.00014	0.35	10.8	0.0	21	52	44	75	41	77	0.89
3	7	0.1	2.6e+02	1.6	0.0	21	44	72	95	70	99	0.86
4	7	0.00082	2.1	8.3	0.1	21	46	100	125	98	133	0.90
5	7	0.0058	15	5.6	0.1	23	49	134	160	131	163	0.86
6	7	0.00064	1.7	8.7	0.0	21	52	160	191	156	192	0.89
7	7	0.00061	1.6	8.7	0.1	21	46	188	213	184	223	0.87

Coding Sequence: ATGTCACAGGCAGTGGAGAGCgccggcagcgagaagattcccaactgctcgaaaccgttcgagtgctctgaatgcaacaaactgttccgccagctcagcactctgactaaccacatgaagatccacaccggcgagaagccgtacaagtgcaccatttgtgcgaaggagttccgccaaacgaccacgctgtccaatcacctgaagattcacaccggtgaaaagccgttcaattgcaacttctgtggcaaacagttccggcagctgagcaccctgtcgaaccatcagaagatccacaccggcgagaagccgttcgagtgctcggtgtgcggcaaacagttccgccagtccagcacgctcaacagtcatatcaggatccactcggatgataagttttGCATAAAACCCTTCAAATGCAGCATCTGTCCCAAGGAATTTCGTCAGACGACGACACTCTCGAATCACATTAAAATTCACACAGgtgaaaagccgtacgcctgcacgtactgcggcaaaatgttccgccagacgggaacgctttccaatcatctgaaaattcacaccggcgaaaaaccgttcgaatgctcggtgtgcggcaaacagttccgccagtccagtaccttgaacagccacatacgtatccatgcggacgataagtattGTAAACCTTCGAGCCCCCCAACCATTAGCACAACGGTCACCGGTGGACTCAACATAAAGGTTGAGGACATCAAACCATTTTACGCGCTGATCTAA
Protein Sequence: MSQAVESAGSEKIPNCSKPFECSECNKLFRQLSTLTNHMKIHTGEKPYKCTICAKEFRQTTTLSNHLKIHTGEKPFNCNFCGKQFRQLSTLSNHQKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHSDDKFCIKPFKCSICPKEFRQTTTLSNHIKIHTGEKPYACTYCGKMFRQTGTLSNHLKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHADDKYCKPSSPPTISTTVTGGLNIKVEDIKPFYALI

Sequence clustering based on sequence similarity using MMseqs2