Aali004187.1
Basic Information
- Insect
- Anopheles albimanus
- Gene Symbol
- Aef1_2
- Assembly
- GCA_013758885.1
- Location
- NC:57551012-57555001[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.009 34 4.0 0.1 22 49 16 43 11 46 0.84 2 7 0.00016 0.61 9.6 0.0 21 52 43 74 41 75 0.88 3 7 0.024 91 2.6 0.0 21 47 71 97 67 102 0.84 4 7 0.00037 1.4 8.4 0.1 21 46 99 124 94 132 0.90 5 7 0.0027 10 5.7 0.1 23 49 133 159 129 162 0.86 6 7 0.00036 1.3 8.5 0.0 21 51 159 189 157 190 0.88 7 7 0.00033 1.2 8.6 0.1 21 46 187 212 185 222 0.87
Sequence Information
- Coding Sequence
- ATGTCACAGGCGGTGGAGAGTGCCGGCGCCAAGATTGCAAATTGCTCGAAACCCTTCGAGTGTACGGAATGCCACAAACTGTTCCGACAGCTGAGCACCCTGACCAACCACATGAAGATACACACCGGCGAGAAGCCGTACAAGTGTTTGATTTGCGCGAAAGAATTCCGCCAAACGACCACGCTGTCCAACCACCTGAAAATACATACCGGTGAAAAACCGTTCAACTGTACCTTCTGTGGCAAGCAGTTCCGCCAGCTGAGCACCCTGTCGAACCACCAGAAGATCCACACGGGCGAAAAACCGTTCGAGTGCACGGTATGCGGCAAACAGTTCCGCCAGTCCAGCACGCTCAACAGCCACATCAGGATACATTCGGATGATAAGTTCTGCATAAAACCCTTCAAATGCAGCATCTGTCCGAAGGAATTTCGCCAGACGACTACCCTTTCCAATCACATTAAAATTCACACAGGTGAAAAGCCGTTCGCCTGTACGTACTGCAACAAAACGTTCCGCCAGACGGGAACGCTTTCCAATCATCTTAAGATCCACACCGGCGAAAAGCCGTTCGAATGCTCGGTATGCGGCAAACAGTTTCGTCAATCCAGTACCTTGAACAGCCACATACGTATTCACGCGGATGATAAGTATTgtaaACCAACGTCACCATCaaccgccggtgccggtgagctgAGCATTAAGCTCGAGGACATTAAGCCCCTCTACACGCTCATCTAA
- Protein Sequence
- MSQAVESAGAKIANCSKPFECTECHKLFRQLSTLTNHMKIHTGEKPYKCLICAKEFRQTTTLSNHLKIHTGEKPFNCTFCGKQFRQLSTLSNHQKIHTGEKPFECTVCGKQFRQSSTLNSHIRIHSDDKFCIKPFKCSICPKEFRQTTTLSNHIKIHTGEKPFACTYCNKTFRQTGTLSNHLKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHADDKYCKPTSPSTAGAGELSIKLEDIKPLYTLI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01462352;
- 90% Identity
- iTF_00106137;
- 80% Identity
- iTF_00092304;