Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.009 34 4.0 0.1 22 49 16 43 11 46 0.84

2 7 0.00016 0.61 9.6 0.0 21 52 43 74 41 75 0.88

3 7 0.024 91 2.6 0.0 21 47 71 97 67 102 0.84

4 7 0.00037 1.4 8.4 0.1 21 46 99 124 94 132 0.90

5 7 0.0027 10 5.7 0.1 23 49 133 159 129 162 0.86

6 7 0.00036 1.3 8.5 0.0 21 51 159 189 157 190 0.88

7 7 0.00033 1.2 8.6 0.1 21 46 187 212 185 222 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.009	34	4.0	0.1	22	49	16	43	11	46	0.84
2	7	0.00016	0.61	9.6	0.0	21	52	43	74	41	75	0.88
3	7	0.024	91	2.6	0.0	21	47	71	97	67	102	0.84
4	7	0.00037	1.4	8.4	0.1	21	46	99	124	94	132	0.90
5	7	0.0027	10	5.7	0.1	23	49	133	159	129	162	0.86
6	7	0.00036	1.3	8.5	0.0	21	51	159	189	157	190	0.88
7	7	0.00033	1.2	8.6	0.1	21	46	187	212	185	222	0.87

Coding Sequence: ATGTCACAGGCGGTGGAGAGTGCCGGCGCCAAGATTGCAAATTGCTCGAAACCCTTCGAGTGTACGGAATGCCACAAACTGTTCCGACAGCTGAGCACCCTGACCAACCACATGAAGATACACACCGGCGAGAAGCCGTACAAGTGTTTGATTTGCGCGAAAGAATTCCGCCAAACGACCACGCTGTCCAACCACCTGAAAATACATACCGGTGAAAAACCGTTCAACTGTACCTTCTGTGGCAAGCAGTTCCGCCAGCTGAGCACCCTGTCGAACCACCAGAAGATCCACACGGGCGAAAAACCGTTCGAGTGCACGGTATGCGGCAAACAGTTCCGCCAGTCCAGCACGCTCAACAGCCACATCAGGATACATTCGGATGATAAGTTCTGCATAAAACCCTTCAAATGCAGCATCTGTCCGAAGGAATTTCGCCAGACGACTACCCTTTCCAATCACATTAAAATTCACACAGGTGAAAAGCCGTTCGCCTGTACGTACTGCAACAAAACGTTCCGCCAGACGGGAACGCTTTCCAATCATCTTAAGATCCACACCGGCGAAAAGCCGTTCGAATGCTCGGTATGCGGCAAACAGTTTCGTCAATCCAGTACCTTGAACAGCCACATACGTATTCACGCGGATGATAAGTATTgtaaACCAACGTCACCATCaaccgccggtgccggtgagctgAGCATTAAGCTCGAGGACATTAAGCCCCTCTACACGCTCATCTAA
Protein Sequence: MSQAVESAGAKIANCSKPFECTECHKLFRQLSTLTNHMKIHTGEKPYKCLICAKEFRQTTTLSNHLKIHTGEKPFNCTFCGKQFRQLSTLSNHQKIHTGEKPFECTVCGKQFRQSSTLNSHIRIHSDDKFCIKPFKCSICPKEFRQTTTLSNHIKIHTGEKPFACTYCNKTFRQTGTLSNHLKIHTGEKPFECSVCGKQFRQSSTLNSHIRIHADDKYCKPTSPSTAGAGELSIKLEDIKPLYTLI

Sequence clustering based on sequence similarity using MMseqs2