Basic Information

Gene Symbol
HmgD_1
Assembly
GCA_018904035.1
Location
JAEIFZ010000238.1:6099256-6099685[-]

Transcription Factor Domain

TF Family
HMG
Domain
HMG_box domain
PFAM
PF00505
TF Group
Other Alpha-Helix Group
Description
High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 9.7e-24 8.5e-21 74.1 1.2 1 68 5 70 5 71 0.98

Sequence Information

Coding Sequence
ATGGCCGACAAACCAAAACGCCCGCTCTCCGCTTACATGCTGTGGCTGAACAGCGCTCGCGAGTCGATCAAACGTGAGAATCCCGGCATCAAAGTCACCGAGGTGGCCAAGCGTGGTGGTGAATTATGGAGAGCAATGAAGGACAAGTCTGAGTGGGAGGCTAAGGCAGCCAAGGCCAAGGACGATTACGATCGTGCCGTCAAAGATTTCGAGGCCAACGGCGGCAGCAGTGCTGCCAATGGCAGTGCCAAGAAGCGTTCGAAACCCGTAAAGAAGCCAGCGAAAAAGAGCAAAAAGGAGGATTCCGATGATGATGATGATGATGAGAGCGAATAG
Protein Sequence
MADKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKDFEANGGSSAANGSAKKRSKPVKKPAKKSKKEDSDDDDDDESE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00512690; iTF_00575553; iTF_00616872; iTF_00563148; iTF_00566764; iTF_00497358; iTF_00506833; iTF_00805937; iTF_00522930; iTF_00567507; iTF_00475188; iTF_01323349; iTF_00579254; iTF_01326366; iTF_00832131; iTF_01356104; iTF_00062756; iTF_00061094; iTF_00592364; iTF_00592365; iTF_00061917; iTF_00514148; iTF_00499557; iTF_00598853; iTF_00485831; iTF_00616169; iTF_00542410; iTF_00577035; iTF_00518412; iTF_00564622; iTF_00501775; iTF_00553008; iTF_00582930; iTF_00513429; iTF_00557179; iTF_01319003; iTF_00576316; iTF_00570367; iTF_01556805; iTF_01550250; iTF_01559729; iTF_01555384; iTF_01558264; iTF_01550971; iTF_00890950; iTF_01195243; iTF_01363915; iTF_00891855; iTF_00890103; iTF_00251321; iTF_01195968; iTF_00553706; iTF_00562443; iTF_00472336; iTF_00556499; iTF_00592362; iTF_00596619; iTF_00539631; iTF_00504660; iTF_00619124; iTF_00607767; iTF_00591672; iTF_00507584; iTF_00566049; iTF_00481512; iTF_00538926; iTF_00550222; iTF_00487967; iTF_00618369; iTF_00571111; iTF_00503241; iTF_00555820; iTF_00612045; iTF_00483662; iTF_00555056; iTF_00577751; iTF_00501017; iTF_00590943; iTF_00600287; iTF_00604063; iTF_00489346; iTF_00477989; iTF_00613479; iTF_00492201; iTF_00527278; iTF_00612783; iTF_00485104; iTF_00617616; iTF_00593809; iTF_00533074; iTF_00541043; iTF_00594518; iTF_00569657; iTF_00488635; iTF_00491484; iTF_00525852; iTF_00561727; iTF_00606276; iTF_00480134; iTF_00531624; iTF_00571868; iTF_00590208; iTF_00804362; iTF_00579947; iTF_00615531; iTF_00545933; iTF_00503959; iTF_00614875; iTF_00477308; iTF_01556093; iTF_00475902; iTF_00545936; iTF_00523667; iTF_00543092; iTF_00609140; iTF_00482949; iTF_00490047; iTF_00524389; iTF_01181131; iTF_00533772; iTF_00557884; iTF_00608412; iTF_00583649; iTF_00537484; iTF_00589517; iTF_00614157; iTF_00509073; iTF_00520602; iTF_00595217; iTF_01414990; iTF_00535281; iTF_00543714; iTF_00511248; iTF_00552275; iTF_00500280; iTF_00498844; iTF_00508298; iTF_00541731; iTF_00478694; iTF_00548775; iTF_00804361; iTF_00525098; iTF_00521325; iTF_00561007; iTF_00568948; iTF_00495830; iTF_00597334; iTF_00470840; iTF_00496571; iTF_00530236; iTF_00522143; iTF_00547327; iTF_00359424; iTF_00585938; iTF_00588116; iTF_00529537; iTF_00536737; iTF_00581505; iTF_00578509; iTF_00604813; iTF_00588110; iTF_00494355; iTF_00494356; iTF_00494357; iTF_00602556; iTF_00338306; iTF_00559458; iTF_00573289; iTF_00476595; iTF_00582227; iTF_00532341; iTF_00586648; iTF_00568223; iTF_00548037; iTF_00574022; iTF_00560234; iTF_00558635; iTF_00495085; iTF_00593074; iTF_00528020; iTF_00482205; iTF_00609856; iTF_00473031; iTF_00565347; iTF_00551557; iTF_00549520; iTF_00540338; iTF_00554356; iTF_00479452; iTF_00915303; iTF_00914472; iTF_00598121; iTF_00918058; iTF_00918059; iTF_01552427; iTF_00916204; iTF_00919790; iTF_00919791; iTF_00919025; iTF_01553937; iTF_00917176; iTF_01548828; iTF_00610621; iTF_00605544; iTF_00486539; iTF_00511980; iTF_00505375; iTF_00335852; iTF_00337493; iTF_00901471; iTF_00339118; iTF_00585167; iTF_00588113; iTF_00588112; iTF_00588114; iTF_00494359; iTF_00588115; iTF_00588117; iTF_00588118; iTF_00572569; iTF_00516229; iTF_00509786; iTF_00519130; iTF_00805154; iTF_00494364; iTF_00546622; iTF_00803569; iTF_00519890; iTF_00502494; iTF_00599552; iTF_00493616; iTF_00091217; iTF_00601760; iTF_00538199; iTF_01322615; iTF_00492930; iTF_01327137; iTF_00506082; iTF_00526549; iTF_00534551; iTF_01324866; iTF_00528775; iTF_00587368; iTF_00588808; iTF_01321161; iTF_01553198; iTF_01554670; iTF_01327860; iTF_01559005; iTF_00802815; iTF_00802816; iTF_01549545; iTF_01324081; iTF_01321891; iTF_00580691; iTF_00480833; iTF_00487266; iTF_00563874; iTF_00601026; iTF_00474473; iTF_00514860; iTF_00536014; iTF_00517680; iTF_00603314; iTF_00473751; iTF_00611320; iTF_00484413; iTF_00471583; iTF_00574783; iTF_01320443; iTF_01325635; iTF_00545208; iTF_00544461; iTF_01551704; iTF_00584396; iTF_00530924; iTF_00550869; iTF_00490750; iTF_01378365; iTF_00336704; iTF_01319731;
90% Identity
iTF_00508298;
80% Identity
-