Dere007493.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Drosophila erecta
Gene Symbol
HmgD
Assembly
GCA_000005135.1
Location
CH954179.1:11752018-11752422[+]

Transcription Factor Domain

TF Family
HMG
Domain
HMG_box domain
PFAM
PF00505
TF Group
Other Alpha-Helix Group
Description
High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 1.9e-23 1.1e-20 73.8 1.6 1 68 5 70 5 71 0.98

Sequence Information

Coding Sequence
ATGTCTGATAAGCCAAAACGCCCACTCTCCGCCTACATGCTGTGGCTCAACAGTGCCCGCGAGTCGATCAAGCGCGAGAATCCCGGCATCAAGGTCACCGAGGTGGCCAAGCGCGGTGGCGAATTATGGAGGGCAATGAAGGACAAGTCTGAGTGGGAGGCCAAGGCTGCCAAGGCTAAGGATGACTATGATCGGGCTGTCAAGGAGTTCGAGGCCAATGGTGGCAGCAGTGCTGCCAACGGTGGAGCCAAGAAGCGCGCGAAACCAGCGAAAAAGGCATCGAAGAAGAGCAAGAAGGAGGAGtccgacgaggacgacgatgatgagAGCGAGTAA
Protein Sequence
MSDKPKRPLSAYMLWLNSARESIKRENPGIKVTEVAKRGGELWRAMKDKSEWEAKAAKAKDDYDRAVKEFEANGGSSAANGGAKKRAKPAKKASKKSKKEESDEDDDDESE*

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01557533;
90% Identity
iTF_00489346; iTF_00606276; iTF_00477989; iTF_00482949; iTF_00524389; iTF_00480134; iTF_00571111; iTF_00613479; iTF_00481512; iTF_00531624; iTF_00492201; iTF_00503241; iTF_00804361; iTF_00612045; iTF_00483662; iTF_00527278; iTF_00538926; iTF_00550222; iTF_00612783; iTF_00485104; iTF_00555056; iTF_00617616; iTF_00593809; iTF_00533074; iTF_00523667; iTF_00541043; iTF_00609140; iTF_00619124; iTF_00594518; iTF_00577751; iTF_00607767; iTF_00591672; iTF_00501017; iTF_00569657; iTF_00488635; iTF_00491484; iTF_00525852; iTF_00571868; iTF_00487967; iTF_00490047; iTF_00561727; iTF_00590943; iTF_00600287; iTF_00604063; iTF_00507584; iTF_00590208; iTF_00592362; iTF_00596619; iTF_00539631; iTF_01319731; iTF_00547327; iTF_00605544; iTF_00615531; iTF_00545933; iTF_00503959; iTF_00614875; iTF_00545936; iTF_00592365; iTF_00592364; iTF_00543092; iTF_00588116; iTF_00529537; iTF_00536737; iTF_00581505; iTF_00559458; iTF_00805154; iTF_00565347; iTF_00516229; iTF_00548037; iTF_00551557; iTF_00473031; iTF_00573289; iTF_00486539; iTF_00511980; iTF_00578509; iTF_00604813; iTF_00588110; iTF_00493616; iTF_00549520; iTF_00588112; iTF_00588113; iTF_00540338; iTF_00588114; iTF_00476595; iTF_00494355; iTF_00582227; iTF_00494356; iTF_00554356; iTF_00494357; iTF_00532341; iTF_00579254; iTF_00494359; iTF_00586648; iTF_00572569; iTF_00519130; iTF_00479452; iTF_00602556; iTF_00505375; iTF_00568223; iTF_00599552; iTF_00588115; iTF_00588117; iTF_00588118; iTF_00475902; iTF_00566049; iTF_00579947; iTF_00477308;
80% Identity
iTF_00607767;