Tzet003269.1
Basic Information
- Insect
- Trachymyrmex zeteki
- Gene Symbol
- Sub1_1
- Assembly
- GCA_001594055.1
- Location
- NW:3035252-3036871[-]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.18 1.9e+03 -2.3 2.1 23 37 38 54 28 54 0.62 2 2 1.8e-27 1.9e-23 81.0 0.7 1 51 63 114 63 115 0.97
Sequence Information
- Coding Sequence
- ATGTTATTTTCCAGgacGTTTGTGAAGATGCCAAAGTCAAAAGAATATCTCTCTGACAGTGATGATAGCAGTGAAGaggaaGTAAAATCAAAGAAGAAGCAAAAGAGGGTAAGAGAAGATGATAATAAAGCGgcaaaagaagagaagaaaccAGCAAAGAAGGCAAAAACAGATGATGACACTGTTTGGGACTTGGGCAACAATCGTCAAGTAAATGTGAGAAACTTCAAAGGCAAATATTATGTTGATATCCGGGAGATGTATTATGATAAGGACGGTGATTTAAAACCTGGGAAAAAAGgaatatttttatctatgcAACAATGGCGAAAATTCATGGATGTTGTGGAAGAAGTGGATAATGTGGCCAAATCAAAGagttag
- Protein Sequence
- MLFSRTFVKMPKSKEYLSDSDDSSEEEVKSKKKQKRVREDDNKAAKEEKKPAKKAKTDDDTVWDLGNNRQVNVRNFKGKYYVDIREMYYDKDGDLKPGKKGIFLSMQQWRKFMDVVEEVDNVAKSKS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01229030;
- 90% Identity
- iTF_01476180;
- 80% Identity
- -