Sric008530.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Samia ricini
Gene Symbol
-
Assembly
None
Location
BLXV01000007:25409156-25441259[-]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 16 8e-05 0.0053 17.3 0.1 3 23 132 152 131 152 0.97
2 16 7.3e-07 4.8e-05 23.8 1.2 1 23 158 180 158 180 0.99
3 16 4.5e-06 0.0003 21.3 2.7 1 23 186 208 186 208 0.99
4 16 2.5e-05 0.0017 18.9 2.1 1 23 223 245 223 245 0.98
5 16 4.1e-05 0.0027 18.2 3.1 1 23 260 282 260 282 0.98
6 16 2.8e-07 1.8e-05 25.1 1.4 1 23 297 319 297 319 0.99
7 16 0.00013 0.0084 16.7 2.8 1 23 325 347 325 347 0.98
8 16 0.029 1.9 9.3 1.8 1 23 354 376 354 376 0.98
9 16 4.9e-07 3.2e-05 24.3 2.3 1 23 382 404 382 404 0.99
10 16 0.034 2.2 9.1 1.8 1 23 411 433 411 433 0.98
11 16 2e-06 0.00013 22.4 1.5 1 23 439 461 439 461 0.99
12 16 0.003 0.2 12.4 0.8 1 23 468 490 468 490 0.99
13 16 2.2e-06 0.00014 22.3 1.9 1 23 496 518 496 518 0.98
14 16 0.0016 0.11 13.2 0.3 1 20 524 543 524 546 0.93
15 16 3.1e-05 0.002 18.6 1.4 2 23 553 574 552 574 0.96
16 16 2.4e-06 0.00016 22.1 1.3 1 23 580 603 580 603 0.97

Sequence Information

Coding Sequence
atgttcgaacaacagatcaaggctgagcccatgagcttctacacatcccatccacacatccactccggtcctccgacaataatccgttcagattccaaccaaggaatcatcaacatgcaccaccagcatcaccaggaggactcgaaagacagccttatacaacaacaagtacaacaccaacaagatctcatggaacagcatcaacatcaacaacaggaaatgcatcaacaagatgatgagcttagcttcaaaggaattgacgacgaaggtgtggaattagaaatggatagtcgccattgctctcagggtatgggggttgacatgggatcagtacagactaaaatggaagtatcgaacggtggtcaacctgcagcacgctccaaaccacaagcctgtaaggtttgcggtaaagtattatcgtccgcttcgtcctattatgttcacatgaagcttcattccgggaataagcccttccaatgtacggtttgcgatgcggccttttgccgtaaaccatatttggaagtgcacatgcgcacgcacacgggagaacgcccattccaatgtgatctatgcctgaaacgtttcacacaaaaatccagtctaaacacgcacaaacgcgtacacacagatgagcacatgcgcgcgttgttggtgaaggaccggccctacaggtgtgatctctgtctgatgcggttcacgcagagctccagcctcaatcgacacaagaaaatacacacggaggagcacagacgagccctgttagagaaagtgcggccctaccagtgccacatctgttttatgcgcttcactcagaagtccagcctgggacgacatgggaaaatacacactgaggagcacatccaatcgctgatcaacaaagtgcgcccctatcaatgcgagatctgtgacaagcggttcactcagaagtccagccttggcactcataaacgtatacacaccggggagcgcccgttccagtgcaccgtctgcctcaagtccttcacgcagaagtgcgcgctcaatttgcacgaaaaaatacatacggtccagggcagaccgttccagtgcctgtcgtgccccgccgccttcacctgcaagcaatacttggagattcacacgcgcacccacaccggcgagcggccgtatcagtgcgacatctgcttgaagcgcttcacgcagaagtccagtctcaacatacacaagcggacgcattcagtgcagggccgcccgttccagtgcctgcagtgccccgccgcgttcacctgcaagcagtacctcgagatacacaaccgcacgcacaccggcgagcgcccctaccagtgcgacgtctgcctcaagagattcgcgcaaaaatcaactctcaatatacacaaacgaacgcacacagtgcaaggtcgcccgtaccaatgtatggagtgtccggcggcgttcacgtgcaagccgtacctggagatacacacgcgcacgcacacgggcgaacgaccgttcgagtgcgatgtttgttacaaacgcttcacccagaaatcgaccctcaacattcacaagcgcattcatactggtgaacgcccatatgcctgtgatatttgtcaaaaacgattcgccgtgaagagttatgttacagctcacagatggtcgcacgtggcggacaagccccttaactgcgaccggtgctcgatgacgttcacgtccaagtcccagttcgctttgcacatccgcacgcattccgccggctcctgctacgagtgtagcgtctgcggccggagcttcgttagagatagctatcttataaggcatcacaatcgtgtgcatcgtgaaaatcacagtaacgtctcagcgaacagtatcggaacaataaacagtgtcgcaacgaacacgaacaattctaacagtaatttcgattcaccgggcgtttgtgatttgagtttcgtgccaatggttaaccggtatatgacatcgcaagggactcaagtgtcgatgcaggatacacacagtaaaatgtcggccatgtcacctcagtccattgcttctatgtcatcaccccctccatcacacactccgacgcctcaaccccagatgtctggacagatgcatctggcagactga
Protein Sequence
MFEQQIKAEPMSFYTSHPHIHSGPPTIIRSDSNQGIINMHHQHHQEDSKDSLIQQQVQHQQDLMEQHQHQQQEMHQQDDELSFKGIDDEGVELEMDSRHCSQGMGVDMGSVQTKMEVSNGGQPAARSKPQACKVCGKVLSSASSYYVHMKLHSGNKPFQCTVCDAAFCRKPYLEVHMRTHTGERPFQCDLCLKRFTQKSSLNTHKRVHTDEHMRALLVKDRPYRCDLCLMRFTQSSSLNRHKKIHTEEHRRALLEKVRPYQCHICFMRFTQKSSLGRHGKIHTEEHIQSLINKVRPYQCEICDKRFTQKSSLGTHKRIHTGERPFQCTVCLKSFTQKCALNLHEKIHTVQGRPFQCLSCPAAFTCKQYLEIHTRTHTGERPYQCDICLKRFTQKSSLNIHKRTHSVQGRPFQCLQCPAAFTCKQYLEIHNRTHTGERPYQCDVCLKRFAQKSTLNIHKRTHTVQGRPYQCMECPAAFTCKPYLEIHTRTHTGERPFECDVCYKRFTQKSTLNIHKRIHTGERPYACDICQKRFAVKSYVTAHRWSHVADKPLNCDRCSMTFTSKSQFALHIRTHSAGSCYECSVCGRSFVRDSYLIRHHNRVHRENHSNVSANSIGTINSVATNTNNSNSNFDSPGVCDLSFVPMVNRYMTSQGTQVSMQDTHSKMSAMSPQSIASMSSPPPSHTPTPQPQMSGQMHLAD

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_01246112;
90% Identity
iTF_00820300; iTF_01317500; iTF_01316576;
80% Identity
-