Oiva012470.1
Basic Information
- Insect
- Oeneis ivallda
- Gene Symbol
- Lztr1
- Assembly
- GCA_029955525.1
- Location
- JARPMR010000008.1:6992971-7001158[-]
Transcription Factor Domain
- TF Family
- BTB
- Domain
- zf-C2H2|ZBTB
- PFAM
- PF00651
- TF Group
- Zinc-Coordinating Group
- Description
- The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.13 87 4.8 0.0 85 109 2 26 1 27 0.91 2 4 3.7 2.4e+03 0.2 0.0 77 108 26 57 23 59 0.84 3 4 3.1e-17 2e-14 55.1 0.0 9 97 122 210 119 225 0.87 4 4 0.78 5.1e+02 2.3 0.0 77 106 224 253 219 257 0.80
Sequence Information
- Coding Sequence
- ATGGAAGTCCTGCGGCTCGCTCTCCGCCTGAACATCCCGCGGCTGCGCGGGCTGTGCGCGCGCTACCTGCGCGCCAACCTGTGCTACAGCAACGTGCTGCAGGCGCTGCACGCCGCGCACCACGCCAACCTGGGCAGCATCAAGGAGTACTGCTTGCGGTTCGTAGTGAAGGACTACAACTTCACGGCCATCGTGATGTCGCCCGAGTTCGAGCAGATGGAGCAGAAGCTGATGGTGGAGGTGATCCgccgccgccaccagccgcAGCCGCACAAGCCGCCGCCCAACCACGACCAAGAGGAGGAGGTCATCGGTACCACGCTGGAGCAAGATATGTGCGTGTTCGTGGGCGGCGGGGGCGCGGACCTGGCGGACGTCAAGCTGCGAGTGGCGGGCGCCATGAAGCCGGCGCACCGCTCCATCCtggccgcgcgcgccgcctacTTCGAGGCCATGTTCCGCTCGTTCTCGCCGCAGGACAACGTTGTGAATATACAAATCTGCGACACGGTGCCATCGGAGGAGGCTTTCGACTCGCTGCTGAGGTACATATACTACGGCGATACCAACATGCCCACCGAAGACTCTCTGTACTTGTTCCAAGCGCCCATATATTACGgcttCACCAACAACCGTCTCCAAGTGTTCTGCAAGCACAATCTGCAGAGTAACGTGTCGCCAGACAACGTGCTCGCGATCCTGCAGGCGGCCGACCGCATGCACGCCGCCGACATCAAGGAGTACGCGCTCAAGATGATCGTGCATCACTTTGAACTGGTGGCTCGACAAGAAGCCATCAAGAACCTCGCCCAGCCTCTGCTGGTGGACATGATCTGGGCGCTTGCGGAGGAGCCCCGCTTCGACACGCAGCTCCCCCTGCAGCCACGCTCTCTCCCCTCCTCCTCCTCCGCAGACACCCTCGCCGAAGACCCAGACTACATGCGGCATAGATGCGGCAAGTAG
- Protein Sequence
- MEVLRLALRLNIPRLRGLCARYLRANLCYSNVLQALHAAHHANLGSIKEYCLRFVVKDYNFTAIVMSPEFEQMEQKLMVEVIRRRHQPQPHKPPPNHDQEEEVIGTTLEQDMCVFVGGGGADLADVKLRVAGAMKPAHRSILAARAAYFEAMFRSFSPQDNVVNIQICDTVPSEEAFDSLLRYIYYGDTNMPTEDSLYLFQAPIYYGFTNNRLQVFCKHNLQSNVSPDNVLAILQAADRMHAADIKEYALKMIVHHFELVARQEAIKNLAQPLLVDMIWALAEEPRFDTQLPLQPRSLPSSSSADTLAEDPDYMRHRCGK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00874612; iTF_00779620;
- 90% Identity
- iTF_00779620;
- 80% Identity
- -