Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0025 76 3.8 2.0 11 16 13 18 11 20 0.83

2 4 0.05 1.5e+03 -0.3 1.0 12 15 33 36 32 36 0.94

3 4 7.3e-10 2.2e-05 24.7 2.9 4 21 53 70 51 71 0.87

4 4 0.63 1.9e+04 -3.9 6.9 10 15 83 88 82 89 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0025	76	3.8	2.0	11	16	13	18	11	20	0.83
2	4	0.05	1.5e+03	-0.3	1.0	12	15	33	36	32	36	0.94
3	4	7.3e-10	2.2e-05	24.7	2.9	4	21	53	70	51	71	0.87
4	4	0.63	1.9e+04	-3.9	6.9	10	15	83	88	82	89	0.83

Coding Sequence: ATGTCTGATGACGGTTCCACAACTGTCGAGAAGAAAGGTCGCGGTAGGCCGAAATCTAACGGAACACAATCGGAAGCTAAAGCAGATACCAAAAAAAGAGGAAGACCAGTGGTGCCTGCTAAAACGAAAGAATCTACAAAGTCATCTGATGACGAACAGGCTCCAGTAGCGAAAAGAGGTCGAGGCAGGCCTAAAGGCTCTAAGAAAAAGACGGCTGCTAAAGGAAAGAGTGCACCAGTTGAAGGACGAGGTCGCGGCCGACCACGTAAGGATGCTGCTCCTCCCAAGAAAGATGCTGCATCAACTGAAGAAGAACAAGAGGACGATGAAGAGGAGGAGGGGTCTGACCAGTAA
Protein Sequence: MSDDGSTTVEKKGRGRPKSNGTQSEAKADTKKRGRPVVPAKTKESTKSSDDEQAPVAKRGRGRPKGSKKKTAAKGKSAPVEGRGRGRPRKDAAPPKKDAASTEEEQEDDEEEEGSDQ

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00111682;
90% Identity: iTF_00681667; iTF_01437065; iTF_01251754; iTF_01415858; iTF_00007105; iTF_00761698; iTF_00382634; iTF_01081609; iTF_00284561; iTF_00683379; iTF_00682444; iTF_00318871; iTF_00008031; iTF_00035680; iTF_00034746;
80% Identity: -