Mvio031311.1
Basic Information
- Insect
- Metallyticus violacea
- Gene Symbol
- -
- Assembly
- GCA_030762175.1
- Location
- CM060839.1:72695001-72696458[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 12 0.22 1.7e+02 4.2 0.1 23 52 6 35 2 36 0.82 2 12 0.19 1.5e+02 4.4 0.0 22 52 33 63 30 65 0.85 3 12 1.3 9.8e+02 1.8 0.0 20 48 59 86 57 91 0.85 4 12 0.78 5.9e+02 2.5 0.1 22 48 89 114 84 119 0.82 5 12 0.12 90 5.1 0.1 22 52 117 147 113 148 0.86 6 12 0.32 2.5e+02 3.7 0.0 22 52 145 175 142 177 0.87 7 12 0.0063 4.8 9.2 0.2 22 46 201 225 197 233 0.84 8 12 0.04 31 6.6 0.1 22 52 257 287 253 289 0.89 9 12 1.1 8.5e+02 2.0 0.0 23 52 286 315 283 316 0.87 10 12 0.63 4.8e+02 2.8 0.1 22 51 313 342 310 345 0.83 11 12 0.0044 3.4 9.7 0.1 22 52 369 399 366 401 0.87 12 12 0.011 8.2 8.4 0.0 22 46 425 449 422 457 0.84
Sequence Information
- Coding Sequence
- atgcatcaaggtaagaaatcacataaatgtgaagtttgtggaaagagctttaccaaTACATTTACATTAAGAAGACATCTTTTactgcatgagggtaagaaaccacatacatgtaaagtttgtgggaagagcttttcACAGACATCTACATTAACGggacatcttttaattcatcagggtaagaagccacataaatgtgaactttgtggGAGGAGCTTTACCCAGATATCTACATTAAAGACACATCTCTTGAagcatgaaggtaagaaaccacataaatgtgaaacttGTGGGAGGAGCTTTACCCATACATTTACATTAAGAAGGCATCTTTTAaagcatgagggtaagaagccacataaatgtgaagtttgtgggaagaactttacctATACATTTACATTAAGAAGGCATCTTTTactgcatgagggtaagaaaccacataaatgtgaagtttgcggGAAGAGCTTTTCCCAGACATCTACATTAAGGGGACATTTTTTattgcatgagggtaagaagccacataaatgtgaagtttgtgggaagagctttaccctggCATCTACATTAAAGGCACATCTTTTCGTgcacgagggtaagaaaccaaataaatgtgaagtttgtgggaagtgCTTTACGCAGACATCTACATTAAGAAGACATCTTTTGgcgcatgagggtaagaaaccacataaatgtgaagtttgtgggaagagctttacctatACATCTGTATTAAaggaacatcttttgatacatgagggcaagaaaccacataaatgtgaagtttgtgggaagtgCTTTACCCAGACATCTACATTAGGAAGACATCTTTTactgcatgagggtaagaaaccacataaatgtgacgtttgtgggaagagctttgtTCATACAACTGCATTAAGGGGACATCTTTTgttgcatgagggtaagaaaccacataaatgtgaaatttgtgggaagtgCTTTACCTGGACATCTCATTTGAGGACACATCTTTTGgtacatgagggtaagaaaccacataaatgtgaagattgtgggaagagctttacccgggCATCTATattaagggaacatcttttgatacataagggtaagaaaccaaataaatgtgaagtttgtgggaagaactttacccaGACATCTACATTAAGAAGACATCTATTGATGCATGagagtaagaaaccacataaaagtgaagtttgtgggaagaactttacccGGGCTTCTGTattaagggaacatcttttgatacctgagggtaagaaaccaaataaatgtgaagtttgtgggaggagctttacccagacatctacattaagaagacatcttttgacgcatgagggtaagaaaccacataaaagtgaagtttgtgggaagaactttacccGGGCTTGTACTTTAAGGAGTCATCTTTTGATGCACAAGAGTAAGAATCCATTAATGTGA
- Protein Sequence
- MHQGKKSHKCEVCGKSFTNTFTLRRHLLLHEGKKPHTCKVCGKSFSQTSTLTGHLLIHQGKKPHKCELCGRSFTQISTLKTHLLKHEGKKPHKCETCGRSFTHTFTLRRHLLKHEGKKPHKCEVCGKNFTYTFTLRRHLLLHEGKKPHKCEVCGKSFSQTSTLRGHFLLHEGKKPHKCEVCGKSFTLASTLKAHLFVHEGKKPNKCEVCGKCFTQTSTLRRHLLAHEGKKPHKCEVCGKSFTYTSVLKEHLLIHEGKKPHKCEVCGKCFTQTSTLGRHLLLHEGKKPHKCDVCGKSFVHTTALRGHLLLHEGKKPHKCEICGKCFTWTSHLRTHLLVHEGKKPHKCEDCGKSFTRASILREHLLIHKGKKPNKCEVCGKNFTQTSTLRRHLLMHESKKPHKSEVCGKNFTRASVLREHLLIPEGKKPNKCEVCGRSFTQTSTLRRHLLTHEGKKPHKSEVCGKNFTRACTLRSHLLMHKSKNPLM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00995383; iTF_00995451;
- 90% Identity
- iTF_00995383; iTF_00995451;
- 80% Identity
- iTF_00995383; iTF_00995451;