Basic Information

Insect: Metallyticus violacea
Gene Symbol: -
Assembly: GCA_030762175.1
Location: CM060839.1:72695001-72696458[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 17 3.2e-06 0.00039 22.5 3.0 1 23 8 30 8 30 0.97

2 17 2.6e-06 0.00031 22.8 1.6 1 23 36 58 36 58 0.97

3 17 5.1e-06 0.00062 21.8 2.8 1 23 64 86 64 86 0.98

4 17 7.8e-05 0.0095 18.1 6.9 1 23 92 114 92 114 0.98

5 17 4.1e-05 0.005 19.0 3.4 1 23 120 142 120 142 0.97

6 17 2.5e-05 0.003 19.7 2.1 1 23 148 170 148 170 0.95

7 17 2.1e-06 0.00025 23.1 1.0 1 23 176 198 176 198 0.97

8 17 2.2e-06 0.00026 23.0 2.7 2 23 205 226 204 226 0.96

9 17 1e-05 0.0013 20.9 1.3 1 23 232 254 232 254 0.98

10 17 1.4e-05 0.0018 20.4 3.9 1 23 260 282 260 282 0.97

11 17 6.3e-05 0.0077 18.4 1.8 1 23 288 310 288 310 0.97

12 17 0.00019 0.023 16.9 5.8 1 23 316 338 316 338 0.98

13 17 3.5e-06 0.00043 22.3 0.8 1 23 344 366 344 366 0.97

14 17 9.8e-07 0.00012 24.1 1.3 2 23 373 394 372 394 0.98

15 17 0.0092 1.1 11.6 0.0 5 21 404 420 402 421 0.92

16 17 3.6e-07 4.4e-05 25.5 1.4 2 23 429 450 428 450 0.98

17 17 0.00052 0.063 15.5 0.5 5 23 460 478 458 478 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	17	3.2e-06	0.00039	22.5	3.0	1	23	8	30	8	30	0.97
2	17	2.6e-06	0.00031	22.8	1.6	1	23	36	58	36	58	0.97
3	17	5.1e-06	0.00062	21.8	2.8	1	23	64	86	64	86	0.98
4	17	7.8e-05	0.0095	18.1	6.9	1	23	92	114	92	114	0.98
5	17	4.1e-05	0.005	19.0	3.4	1	23	120	142	120	142	0.97
6	17	2.5e-05	0.003	19.7	2.1	1	23	148	170	148	170	0.95
7	17	2.1e-06	0.00025	23.1	1.0	1	23	176	198	176	198	0.97
8	17	2.2e-06	0.00026	23.0	2.7	2	23	205	226	204	226	0.96
9	17	1e-05	0.0013	20.9	1.3	1	23	232	254	232	254	0.98
10	17	1.4e-05	0.0018	20.4	3.9	1	23	260	282	260	282	0.97
11	17	6.3e-05	0.0077	18.4	1.8	1	23	288	310	288	310	0.97
12	17	0.00019	0.023	16.9	5.8	1	23	316	338	316	338	0.98
13	17	3.5e-06	0.00043	22.3	0.8	1	23	344	366	344	366	0.97
14	17	9.8e-07	0.00012	24.1	1.3	2	23	373	394	372	394	0.98
15	17	0.0092	1.1	11.6	0.0	5	21	404	420	402	421	0.92
16	17	3.6e-07	4.4e-05	25.5	1.4	2	23	429	450	428	450	0.98
17	17	0.00052	0.063	15.5	0.5	5	23	460	478	458	478	0.96

Sequence Information

Coding Sequence: atgcatcaaggtaagaaatcacataaatgtgaagtttgtggaaagagctttaccaaTACATTTACATTAAGAAGACATCTTTTactgcatgagggtaagaaaccacatacatgtaaagtttgtgggaagagcttttcACAGACATCTACATTAACGggacatcttttaattcatcagggtaagaagccacataaatgtgaactttgtggGAGGAGCTTTACCCAGATATCTACATTAAAGACACATCTCTTGAagcatgaaggtaagaaaccacataaatgtgaaacttGTGGGAGGAGCTTTACCCATACATTTACATTAAGAAGGCATCTTTTAaagcatgagggtaagaagccacataaatgtgaagtttgtgggaagaactttacctATACATTTACATTAAGAAGGCATCTTTTactgcatgagggtaagaaaccacataaatgtgaagtttgcggGAAGAGCTTTTCCCAGACATCTACATTAAGGGGACATTTTTTattgcatgagggtaagaagccacataaatgtgaagtttgtgggaagagctttaccctggCATCTACATTAAAGGCACATCTTTTCGTgcacgagggtaagaaaccaaataaatgtgaagtttgtgggaagtgCTTTACGCAGACATCTACATTAAGAAGACATCTTTTGgcgcatgagggtaagaaaccacataaatgtgaagtttgtgggaagagctttacctatACATCTGTATTAAaggaacatcttttgatacatgagggcaagaaaccacataaatgtgaagtttgtgggaagtgCTTTACCCAGACATCTACATTAGGAAGACATCTTTTactgcatgagggtaagaaaccacataaatgtgacgtttgtgggaagagctttgtTCATACAACTGCATTAAGGGGACATCTTTTgttgcatgagggtaagaaaccacataaatgtgaaatttgtgggaagtgCTTTACCTGGACATCTCATTTGAGGACACATCTTTTGgtacatgagggtaagaaaccacataaatgtgaagattgtgggaagagctttacccgggCATCTATattaagggaacatcttttgatacataagggtaagaaaccaaataaatgtgaagtttgtgggaagaactttacccaGACATCTACATTAAGAAGACATCTATTGATGCATGagagtaagaaaccacataaaagtgaagtttgtgggaagaactttacccGGGCTTCTGTattaagggaacatcttttgatacctgagggtaagaaaccaaataaatgtgaagtttgtgggaggagctttacccagacatctacattaagaagacatcttttgacgcatgagggtaagaaaccacataaaagtgaagtttgtgggaagaactttacccGGGCTTGTACTTTAAGGAGTCATCTTTTGATGCACAAGAGTAAGAATCCATTAATGTGA
Protein Sequence: MHQGKKSHKCEVCGKSFTNTFTLRRHLLLHEGKKPHTCKVCGKSFSQTSTLTGHLLIHQGKKPHKCELCGRSFTQISTLKTHLLKHEGKKPHKCETCGRSFTHTFTLRRHLLKHEGKKPHKCEVCGKNFTYTFTLRRHLLLHEGKKPHKCEVCGKSFSQTSTLRGHFLLHEGKKPHKCEVCGKSFTLASTLKAHLFVHEGKKPNKCEVCGKCFTQTSTLRRHLLAHEGKKPHKCEVCGKSFTYTSVLKEHLLIHEGKKPHKCEVCGKCFTQTSTLGRHLLLHEGKKPHKCDVCGKSFVHTTALRGHLLLHEGKKPHKCEICGKCFTWTSHLRTHLLVHEGKKPHKCEDCGKSFTRASILREHLLIHKGKKPNKCEVCGKNFTQTSTLRRHLLMHESKKPHKSEVCGKNFTRASVLREHLLIPEGKKPNKCEVCGRSFTQTSTLRRHLLTHEGKKPHKSEVCGKNFTRACTLRSHLLMHKSKNPLM

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00995943;
90% Identity: iTF_00995943;
80% Identity: iTF_00995943;