Hgut013621.1
Basic Information
- Insect
- Hypselothyrea guttata
- Gene Symbol
- br
- Assembly
- GCA_035045125.1
- Location
- JAWNNJ010002141.1:1233325-1234336[-]
Transcription Factor Domain
- TF Family
- BTB
- Domain
- zf-C2H2|ZBTB
- PFAM
- PF00651
- TF Group
- Zinc-Coordinating Group
- Description
- The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.3e-22 3.3e-20 72.3 0.1 1 86 25 107 25 113 0.92
Sequence Information
- Coding Sequence
- ATGGCTGCCGTGCGGGGTCATCAGTACTTCAGCCTGCGTTGGAATAACTATCAGAACACGATGACGTCAGTGTTCCAGCAGCTGAGAGAGGATCTCTCCTTTGTGGATGTGACCTTGTCCTGTGAGCACGGCTCCCTCAAGGCGCACAAGGTTGTGCTGTCTGCCTGCTCCACATACTTTCAAAAGCTGCTGCTCGAGAATCCCTGTAAACATCCAACGATTATCTTACCCGCCGATATCATATTCACAGATCTGAAAACAATTATCGATTTTGTTTATCGCGGCGAAATCGATGTCACCGAATCCGATCTACAGgGCATTTACATAAGCGACCGCATGCCAATTACCAACCGCTAA
- Protein Sequence
- MAAVRGHQYFSLRWNNYQNTMTSVFQQLREDLSFVDVTLSCEHGSLKAHKVVLSACSTYFQKLLLENPCKHPTIILPADIIFTDLKTIIDFVYRGEIDVTESDLQGIYISDRMPITNR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00558819;
- 90% Identity
- iTF_00359553; iTF_00486658; iTF_01356226; iTF_00503363; iTF_00523790; iTF_00600409; iTF_00512099; iTF_00548163; iTF_00536868; iTF_00575685; iTF_00506969; iTF_00339270; iTF_00528902; iTF_00561129; iTF_00546058; iTF_00586059; iTF_00609260; iTF_00612172; iTF_00804493; iTF_00916332; iTF_00588239; iTF_00061234; iTF_01557650; iTF_00504083; iTF_00484532; iTF_00062064; iTF_00581635; iTF_00492326; iTF_00605671; iTF_00504782; iTF_00538321; iTF_00578641; iTF_00529653; iTF_00062903; iTF_00507703; iTF_01549660; iTF_00511380; iTF_00566902; iTF_00572694; iTF_01323486; iTF_01548950; iTF_00577879; iTF_00483790; iTF_00336058; iTF_00891994; iTF_00337675; iTF_01325018; iTF_00901595; iTF_00558012; iTF_00608541; iTF_00561854; iTF_00481631; iTF_00917313; iTF_00615655; iTF_00477426; iTF_00476021; iTF_00577151; iTF_00904831;
- 80% Identity
- iTF_00588933;