Basic Information

Gene Symbol
br_3
Assembly
GCA_035044385.1
Location
JAWNME010000533.1:5364321-5364761[-]

Transcription Factor Domain

TF Family
BTB
Domain
zf-C2H2|ZBTB
PFAM
PF00651
TF Group
Zinc-Coordinating Group
Description
The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 3.9e-22 4.8e-20 71.9 0.1 1 84 25 105 25 118 0.89

Sequence Information

Coding Sequence
ATGGCTGCCGTGCGGGGTCATCAATATTTTAGCCTGCGCTGGAATAACTATCAGAACACGATGACGTCAGTGTTTCAGCAGCTGCGCGAGGATCTCTCCTTTGTCGATGTAACCTTGTCCTGTGAGCATGGCTCGCTCAAGGCGCACAAGGTTGTTTTATCCGCCTGCTCAACGTATTTCCAAAAGCTGCTGCTCGAGAATCCATGCAAGCATCCAACGATCATCTTACCCGCCGACATCATATTCACAGACCTTAAAacaattatcgattttgtgTATCGCGGCGAAATCGATGTCACCGAATCAGACTTACAGGTGAGTGCCGTTCTTCACAGATCACAGATAATAAAGTTGCCCTAG
Protein Sequence
MAAVRGHQYFSLRWNNYQNTMTSVFQQLREDLSFVDVTLSCEHGSLKAHKVVLSACSTYFQKLLLENPCKHPTIILPADIIFTDLKTIIDFVYRGEIDVTESDLQVSAVLHRSQIIKLP

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00339270; iTF_00574159; iTF_00486658; iTF_00583778; iTF_00503363; iTF_00555940; iTF_00523790; iTF_00600409; iTF_00517827; iTF_00548163; iTF_00536868; iTF_00575685; iTF_00506212; iTF_00519257; iTF_00516360; iTF_00515689; iTF_00259010; iTF_00797889; iTF_01261122; iTF_00483075; iTF_00581635; iTF_00972355; iTF_01133027; iTF_00480260; iTF_00805284; iTF_00899748; iTF_00533189; iTF_00588933; iTF_00492326; iTF_00528902; iTF_01364038; iTF_00537607; iTF_00605671; iTF_00624871; iTF_00891079; iTF_00900743; iTF_00553800; iTF_01554056; iTF_00531753; iTF_00747593; iTF_01174377; iTF_00336874; iTF_00593930; iTF_00832266; iTF_01165642; iTF_00337675; iTF_00350283; iTF_00612907; iTF_00482348; iTF_01201740; iTF_01324236; iTF_01398636; iTF_01553324; iTF_00494477; iTF_00598253; iTF_00504782; iTF_00160847; iTF_00541167; iTF_00588239; iTF_01175247; iTF_01194511; iTF_00538321; iTF_00578641; iTF_01259313; iTF_01313105; iTF_00606418; iTF_01557650; iTF_00495955; iTF_00617747; iTF_01399603; iTF_00511380; iTF_01224724; iTF_01374196; iTF_00491605; iTF_00508437; iTF_00529653; iTF_00488758; iTF_00572694; iTF_00591062; iTF_01327990; iTF_01519478; iTF_00507703; iTF_00524503; iTF_00571991; iTF_01315607; iTF_00485240; iTF_00890232; iTF_00967320; iTF_01196088; iTF_00541849; iTF_00556602; iTF_00891994; iTF_00490171; iTF_00590331; iTF_01322748; iTF_01549660; iTF_00199997; iTF_00489469; iTF_00478110; iTF_00561854; iTF_00565470; iTF_00901598; iTF_01323486; iTF_00979455; iTF_01427583; iTF_00595337; iTF_01559851; iTF_01551821; iTF_01555501; iTF_01551089; iTF_01558389; iTF_01556924; iTF_00609260; iTF_00612172; iTF_00916332; iTF_00604194; iTF_00804493; iTF_00483790; iTF_00555182; iTF_00919154; iTF_00577879; iTF_00484532; iTF_00611444; iTF_00614997; iTF_00470966; iTF_00478822; iTF_00569069; iTF_00062903; iTF_00062064; iTF_00547447; iTF_00506969; iTF_00566902; iTF_00552409; iTF_00531048; iTF_00614282; iTF_00475311; iTF_01326515; iTF_00520724; iTF_00532469; iTF_00514266; iTF_00546750; iTF_00336058; iTF_00585306; iTF_00901595; iTF_00558012; iTF_00603454; iTF_00559583; iTF_00568346; iTF_00577151;
90% Identity
iTF_00552409;
80% Identity
iTF_00588933;