Basic Information

Transcription Factor Domain

TF Family: MBD
Domain: MBD domain
PFAM: PF01429
TF Group: Unclassified Structure
Description: The Methyl-CpG binding domain (MBD) binds to DNA that contains one or more symmetrically methylated CpGs [2]. DNA methylation in animals is associated with alterations in chromatin structure and silencing of gene expression. MBD has negligible non-specific affinity for DNA. In vitro foot-printing with MeCP2 showed the MBD can protect a 12 nucleotide region surrounding a methyl CpG pair [2]. MBDs are found in several Methyl-CpG binding proteins and also DNA demethylase [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.96 3.8e+03 -1.6 0.0 40 60 2 22 1 33 0.78

2 6 0.0035 14 6.2 0.0 34 60 35 61 30 73 0.84

3 6 0.002 7.9 6.9 0.0 34 62 74 102 67 109 0.86

4 6 7.5e-06 0.029 14.7 0.0 33 63 112 142 90 151 0.81

5 6 0.027 1e+02 3.4 0.0 34 64 152 182 149 190 0.84

6 6 0.048 1.9e+02 2.5 0.0 34 47 191 204 186 214 0.83

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.96	3.8e+03	-1.6	40	60	2	22	1	33	0.78
2	6	0.0035	14	6.2	34	60	35	61	30	73	0.84
3	6	0.002	7.9	6.9	34	62	74	102	67	109	0.86
4	6	7.5e-06	0.029	14.7	33	63	112	142	90	151	0.81
5	6	0.027	1e+02	3.4	34	64	152	182	149	190	0.84
6	6	0.048	1.9e+02	2.5	34	47	191	204	186	214	0.83

Coding Sequence: ATGGGAAAACGATCGGAAACCGTAAAACACATTAAGCGGTTCCCGCGGGAAACGATAGGACACCATAGGACCCGAATACTGACGATAGATACGAATAACGAATACTACATAGAACCGATGGGAAAACGATCGGAAACCGTAGAACACATTAAGGGGTTCCCGCGGGAAACGATAGGACACCATAGGACCCGAATACTGACGATAGATACGAATAACGAATACTACATAGAACCGATAGGAAAACGATCGGAAACCGTAGAACACATTAAGGGGTTCCCGCGGGAAACGATAGGACACCATAGGATCCGAATACTGACGATATATACAAATAAAGAATACTACATAGAACCGATGGGAAAACGATTGGAAACCGTAAAACACATTAAGCGGTTCCCGCGGGAAACGATAGGACACCATAGGATCCGAATAGTGACGATAGATACGAATAAAGAATACTACATAGAACCGATGAGAAAACGATCGGAAACCGTAGAACACATTAAGGGGTTCCCGCGAGAAACGATAGGACACCATAGGATCCGAATACTGACGATAGATACAAATAAAGAATACTACATAGAACCGATGGGAAAACGATCGGAAACTGTAGAACACATTAAAGAAAATGCTGCCAGTAATCACAGAAATCCGGAATGA
Protein Sequence: MGKRSETVKHIKRFPRETIGHHRTRILTIDTNNEYYIEPMGKRSETVEHIKGFPRETIGHHRTRILTIDTNNEYYIEPIGKRSETVEHIKGFPRETIGHHRIRILTIYTNKEYYIEPMGKRLETVKHIKRFPRETIGHHRIRIVTIDTNKEYYIEPMRKRSETVEHIKGFPRETIGHHRIRILTIDTNKEYYIEPMGKRSETVEHIKENAASNHRNPE

Sequence clustering based on sequence similarity using MMseqs2