Basic Information

Transcription Factor Domain

TF Family: MBD
Domain: MBD domain
PFAM: PF01429
TF Group: Unclassified Structure
Description: The Methyl-CpG binding domain (MBD) binds to DNA that contains one or more symmetrically methylated CpGs [2]. DNA methylation in animals is associated with alterations in chromatin structure and silencing of gene expression. MBD has negligible non-specific affinity for DNA. In vitro foot-printing with MeCP2 showed the MBD can protect a 12 nucleotide region surrounding a methyl CpG pair [2]. MBDs are found in several Methyl-CpG binding proteins and also DNA demethylase [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.00027 1.1 9.7 0.0 34 64 37 67 21 75 0.87

2 5 0.0015 6 7.3 0.0 34 62 76 104 71 114 0.86

3 5 0.029 1.1e+02 3.2 0.0 34 62 115 143 108 153 0.85

4 5 0.026 1e+02 3.4 0.0 34 64 154 184 150 192 0.84

5 5 0.049 1.9e+02 2.5 0.0 34 47 193 206 188 216 0.83

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.00027	1.1	9.7	34	64	37	67	21	75	0.87
2	5	0.0015	6	7.3	34	62	76	104	71	114	0.86
3	5	0.029	1.1e+02	3.2	34	62	115	143	108	153	0.85
4	5	0.026	1e+02	3.4	34	64	154	184	150	192	0.84
5	5	0.049	1.9e+02	2.5	34	47	193	206	188	216	0.83

Coding Sequence: ATGGCGGACGAGGGAGGGATCGGAAACGGTAACACATTGAAGGAAATCCCGCGGGAAACGATAGGACACCATAGGATCCGAATACTGACGATAGATACGAATAAAGAATACTACATAGAACCGATAGGAAAACGATCGGAAACCGTAGAACACATCAAGGGGTTCCTGCGAGAAACGATAGGACACCATAGGATCCGAATACTGACGATAGATACAAATAAAGAATACTACATAGAACCGATGGGAAAACGATCGGAAACCGTAAAACACATTAAGGGGTTCCCGCGAGAAACGATAGGACACCATAGGATCCGAATAGTGACGATAGATACGAATAAAGAATACTACATAGAACCGATGAGAAAACGATCGGAAACCGTAGAACACATTAAGGGGTTCCCGCGAGAAACGATAGGACACCATAGGATCCGAATAGTGACGATAGATACGAATAAAGAATACTACATAGAACCGATGAGAAAACGATCGGAAACCGTAGAACACATTAAGGGGTTCCCGCGAGAAACGATAGGACACCATAGGATCCGAATACTGACGATAGATACAAATAAAGAATACTACATAGAACCGATGGGAAAACGATCGGAAACTGTAGAACACATTAAAGAAAATGCTGCCAGTAATCACAGAAATCCGGAATGA
Protein Sequence: MADEGGIGNGNTLKEIPRETIGHHRIRILTIDTNKEYYIEPIGKRSETVEHIKGFLRETIGHHRIRILTIDTNKEYYIEPMGKRSETVKHIKGFPRETIGHHRIRIVTIDTNKEYYIEPMRKRSETVEHIKGFPRETIGHHRIRIVTIDTNKEYYIEPMRKRSETVEHIKGFPRETIGHHRIRILTIDTNKEYYIEPMGKRSETVEHIKENAASNHRNPE

Sequence clustering based on sequence similarity using MMseqs2