Dnoa007576.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Dufourea novaeangliae
Gene Symbol
Dsp1
Assembly
GCA_001272555.1
Location
NW:820591-823106[+]

Transcription Factor Domain

TF Family
HMG
Domain
HMG_box domain
PFAM
PF00505
TF Group
Other Alpha-Helix Group
Description
High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 5e-20 1.9e-17 62.5 0.1 1 69 170 238 170 238 0.98

Sequence Information

Coding Sequence
ATGCTTAATAAGTTACGTTCTGCGTTACTTGTAGTCGTTTTTCACGTACTTCTTTGCAACACTGGCTTTCAATTATTGTTGATCACTGTAATTTTACAAAGATTATTAATCTCTTGGGCAAAGGATTGtagaagaacattttttataatcatgGATTCATCTGAcaggaaaaatgtttatctCACGAAAACGGGTGATAATTCATTGAATTCTGGAATGAGAGATACAATGATTGTTGGTCAAACGAATATGACTCCagAATGCGGTGAACCTGTAATGAAACCTGGAAATGTATCCAGTGTTTCAAATAATCAAACAAAATGGTCAAATATGcaaagcaaaaattttattattaatgcaGTACCAGTGAAGAATGAAATTGTACATCTTGAAGATGGGGCACATTGCAATAAGAAAATGCATTACTATGACAGACATTATGTCAGTCATGATGAAACAGAGAAACCAACACGTAGAGGAACAAAAAGATATAGAGATAAAGATGCACCTAAAAGAGCATTGTCtgcatttttctatttttgccAAGAATTACGtggaaaaatgagagaatTACATCCAGAAATGGGAGTTGGTGATATTGCCAAAGAGTTGGGTAAATTGTGGATGAGTACAGATCTTCAAACTAAATCAAAATATATGGCAATAGCAGAAGAGGATAGAGCTCGATATGAAAGAGAAATAATTGCGTACAAcaaaagagtaaaaaattatgatcCCGAAGAAGTTGGACCCGTGTAA
Protein Sequence
MLNKLRSALLVVVFHVLLCNTGFQLLLITVILQRLLISWAKDCRRTFFIIMDSSDRKNVYLTKTGDNSLNSGMRDTMIVGQTNMTPECGEPVMKPGNVSSVSNNQTKWSNMQSKNFIINAVPVKNEIVHLEDGAHCNKKMHYYDRHYVSHDETEKPTRRGTKRYRDKDAPKRALSAFFYFCQELRGKMRELHPEMGVGDIAKELGKLWMSTDLQTKSKYMAIAEEDRARYEREIIAYNKRVKNYDPEEVGPV

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00117985; iTF_00228641; iTF_00760961; iTF_01424353; iTF_00763202; iTF_00215683; iTF_00222499; iTF_00227939; iTF_01067587; iTF_00232580; iTF_00391268; iTF_00864612; iTF_00964452; iTF_01066916; iTF_01070340; iTF_00393574; iTF_01255526; iTF_00633607; iTF_00961799; iTF_00862536; iTF_01065544; iTF_00141801; iTF_00142441; iTF_00223849; iTF_00230665; iTF_00873769; iTF_01122409; iTF_00220554; iTF_00226570; iTF_01069643; iTF_00733932; iTF_01420908; iTF_00140557; iTF_00219085; iTF_00216366; iTF_00224526; iTF_00229326; iTF_00360878; iTF_01417678; iTF_00183919; iTF_01454063; iTF_01068273; iTF_00963826; iTF_00214995; iTF_00230003; iTF_00233203; iTF_00227252; iTF_00141205; iTF_00221237; iTF_00962485; iTF_01089973; iTF_01418325; iTF_00863926; iTF_00866678; iTF_01068950; iTF_01498198; iTF_00217047; iTF_00218391; iTF_00231959; iTF_00966007; iTF_01066231; iTF_00861848; iTF_00982265; iTF_01071001; iTF_00773786; iTF_00983578; iTF_01418970; iTF_00183259; iTF_00762523; iTF_00865979; iTF_01420251; iTF_00217724; iTF_00223164; iTF_00225212; iTF_00963164; iTF_00219773; iTF_00303005; iTF_00221886; iTF_00231294; iTF_00306238; iTF_01123038; iTF_00982943; iTF_01419615; iTF_00214368; iTF_00225888; iTF_00087137; iTF_00087973; iTF_00085350; iTF_00084526; iTF_00086254; iTF_00088796; iTF_01266853; iTF_01269771; iTF_01270477; iTF_01267537; iTF_01271186; iTF_01268245; iTF_01269022; iTF_01477541; iTF_00109798; iTF_01245193; iTF_00730032; iTF_00730712; iTF_00729274; iTF_00279933; iTF_00014695; iTF_00181281; iTF_00016015; iTF_00016655; iTF_01261810; iTF_00015347; iTF_00181940; iTF_00417532; iTF_01476894; iTF_00182591; iTF_01523335; iTF_01513448; iTF_01512808; iTF_01232976; iTF_01514800; iTF_01514129; iTF_01235002; iTF_01232380; iTF_01233630; iTF_01512160; iTF_00860361; iTF_00385290; iTF_01520202; iTF_01423632; iTF_01422899; iTF_01421529; iTF_01422204; iTF_00865292; iTF_01015788; iTF_00684142; iTF_01539580; iTF_00684765; iTF_01254767; iTF_00867370; iTF_00868080; iTF_01077437; iTF_00868768; iTF_00765552; iTF_00264243; iTF_00264973; iTF_01355283; iTF_01476147; iTF_01228347; iTF_01228993; iTF_01406467; iTF_00127428; iTF_01405670; iTF_00125897; iTF_00128174; iTF_00128946; iTF_00129715; iTF_01407251; iTF_01408179; iTF_01354583; iTF_01099162; iTF_00126685; iTF_01409084; iTF_00885080; iTF_00898719;
90% Identity
iTF_00763202; iTF_00864612; iTF_00862536; iTF_00183919; iTF_00863926; iTF_00866678; iTF_00966007; iTF_00861848; iTF_01071001; iTF_00183259; iTF_00762523; iTF_00865979; iTF_00087137; iTF_00087973; iTF_00085350; iTF_00084526; iTF_00086254; iTF_00088796; iTF_00860361;
80% Identity
-