Xvio011287.1
Basic Information
- Insect
- Xylocopa violacea
- Gene Symbol
- Dsp1_2
- Assembly
- GCA_963969225.1
- Location
- CAXAJV010000015.1:21551726-21552862[+]
Transcription Factor Domain
- TF Family
- HMG
- Domain
- HMG_box domain
- PFAM
- PF00505
- TF Group
- Other Alpha-Helix Group
- Description
- High mobility group (HMG) box domains are involved in binding DNA, and may be involved in protein-protein interactions as well. The structure of the HMG-box domain consists of three helices in an irregular array. HMG-box domains are found in one or more copies in HMG-box proteins, which form a large, diverse family involved in the regulation of DNA-dependent processes such as transcription, replication, and strand repair, all of which require the bending and unwinding of chromatin. Many of these proteins are regulators of gene expression. HMG-box proteins are found in a variety of eukaryotic organisms, and can be broadly divided into two groups, based on sequence-dependent and sequence-independent DNA recognition; the former usually contain one HMG-box motif, while the latter can contain multiple HMG-box motifs. HMG-box domains can be found in single or multiple copies in the following protein classes: HMG1 and HMG2 non-histone components of chromatin; SRY (sex determining region Y protein) involved in differential gonadogenesis; the SOX family of transcription factors [1]; sequence-specific LEF1 (lymphoid enhancer binding factor 1) and TCF-1 (T-cell factor 1) involved in regulation of organogenesis and thymocyte differentiation [2]; structure-specific recognition protein SSRP involved in transcription and replication; MTF1 mitochondrial transcription factor; nucleolar transcription factors UBF 1/2 (upstream binding factor) involved in transcription by RNA polymerase I; Abf2 yeast ARS-binding factor [3]; yeast transcription factors lxr1, Rox1, Nhp6b and Spp41; mating type proteins (MAT) involved in the sexual reproduction of fungi [4]; and the YABBY plant-specific transcription factors.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.5e-20 2.5e-17 63.2 0.1 1 69 116 184 116 184 0.98
Sequence Information
- Coding Sequence
- ATGGAATCAAATGACAGGAAAAATGTTTATCTTACAAAAACGAGTGACAATACTTTAAATTCTGGAATGATCGTTGGTCAAACGAATATGACATCAGAATGTGGTGAAGCTGTAATGAAACCTGGAAGTGTGTCCAGTGTTTCAAACAATCAGGCAAAGTGGTCAAATACTCAGAGTAAAAATTTTATTATTAACGCGGTACCAGTGAAAAATGAAATCGTTCACCTCGAAGACGGAGCACATTGCAACAAGAAAATGTATTATTACGATAGACATTATACTGGACACGAAGAAACAGAGAGACCAACGCGCAGGGGAACAAAAAGATACAGGGATAAGGATGCACCTAAAAGGGCATTGTCTGCCTTCTTCTATTTTTGCCAAGAATTGCGAGGAAAGATGAGGGAATTGCATCCAGAAATGGGAGTAGGCGACATTGCTAAAGAGCTGGGCAAACTGTGGATGAGTACAGATCTTCAAACTAAATCTAAGTACATGGCAATAGCAGAGGAAGATAGAGCCAGATATGAAAGAGAAATTATCGCGTACAATAAAAGAGTAAAAAATTATGATCCGGAAGAAGTTGGACCTGTATAA
- Protein Sequence
- MESNDRKNVYLTKTSDNTLNSGMIVGQTNMTSECGEAVMKPGSVSSVSNNQAKWSNTQSKNFIINAVPVKNEIVHLEDGAHCNKKMYYYDRHYTGHEETERPTRRGTKRYRDKDAPKRALSAFFYFCQELRGKMRELHPEMGVGDIAKELGKLWMSTDLQTKSKYMAIAEEDRARYEREIIAYNKRVKNYDPEEVGPV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00625472;
- 90% Identity
- iTF_00733932; iTF_00117985; iTF_00228641; iTF_00760961; iTF_01424353; iTF_00215683; iTF_00222499; iTF_00227939; iTF_01067587; iTF_00232580; iTF_00391268; iTF_00964452; iTF_01066916; iTF_01070340; iTF_00393574; iTF_01255526; iTF_00633607; iTF_00961799; iTF_01065544; iTF_00141801; iTF_00142441; iTF_00223849; iTF_00230665; iTF_00873769; iTF_01122409; iTF_00220554; iTF_00226570; iTF_01069643; iTF_01420908; iTF_00140557; iTF_00219085; iTF_00216366; iTF_00224526; iTF_00229326; iTF_01417678; iTF_01454063; iTF_01068273; iTF_00963826; iTF_00214995; iTF_00230003; iTF_00233203; iTF_00227252; iTF_00141205; iTF_00221237; iTF_00962485; iTF_01418325; iTF_01068950; iTF_01498198; iTF_00217047; iTF_00218391; iTF_00231959; iTF_01066231; iTF_00982265; iTF_00983578; iTF_01418970; iTF_01420251; iTF_00217724; iTF_00223164; iTF_00225212; iTF_00963164; iTF_00219773; iTF_00303005; iTF_00221886; iTF_00231294; iTF_00306238; iTF_01123038; iTF_00982943; iTF_01419615; iTF_00214368; iTF_00225888;
- 80% Identity
- -