Basic Information

Insect: Drosophila paracracens
Gene Symbol: -
Assembly: GCA_035044025.1
Location: JAWNMN010000160.1:1235326-1235751[+]

Transcription Factor Domain

TF Family: zf-LITAF-like
Domain: zf-LITAF-like domain
PFAM: PF10601
TF Group: Zinc-Coordinating Group
Description: Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 1.2e-27 1e-24 86.4 17.3 2 70 33 101 32 101 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	1.2e-27	1e-24	86.4	17.3	2	70	33	101	32	101	0.97

Sequence Information

Coding Sequence: ATGAGTCAGGGATATACACCAGCGCAGACCTACCAGCCCGGAGGACCAGTAATCATACAGACAACGACCACAACGAATGTGGTGCCCATCGGGAGTCATCCATCGCAGGTGCAGTGCCCCTCCTGCCATGCCCATGTCCTGACCAATGTGAAACGTCAGCCAACAGGACGTACACATTGCTTTGCCTTGATGTTGTGCCTATTCCTATGCTGGccctgtgtttgtgtgccctACTGCGTGGACTCCTGCATGAATGCCGAACACTCATGCCCCAATTGCGGAGCCTACATTGGCACATACGAGAGCTAG
Protein Sequence: MSQGYTPAQTYQPGGPVIIQTTTTTNVVPIGSHPSQVQCPSCHAHVLTNVKRQPTGRTHCFALMLCLFLCWPCVCVPYCVDSCMNAEHSCPNCGAYIGTYES

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00560705; iTF_00610306; iTF_00610307; iTF_00498532; iTF_00542820; iTF_00495526; iTF_00574470; iTF_00574471; iTF_00518824; iTF_00502185; iTF_00528457; iTF_00528458; iTF_00593515; iTF_01328267; iTF_00565036; iTF_00583343; iTF_00599247; iTF_00497808; iTF_00497042; iTF_00559154; iTF_00497043; iTF_00559155; iTF_00553428; iTF_00597813; iTF_00513846; iTF_00570774; iTF_00597814; iTF_00597815; iTF_00482649; iTF_00576729; iTF_00577433; iTF_00607482; iTF_00557563; iTF_00499964; iTF_00521820; iTF_00616573; iTF_00620254; iTF_00517375; iTF_00486240; iTF_00567200; iTF_00596320; iTF_01322305; iTF_01326826; iTF_01324561; iTF_00587805; iTF_00513122; iTF_00538626; iTF_00579650; iTF_00595618; iTF_00599970; iTF_00545637; iTF_00584837; iTF_01557221; iTF_00473447; iTF_00563559; iTF_00534248; iTF_01555785; iTF_00509483; iTF_00617291; iTF_00614572; iTF_00529229; iTF_00547726; iTF_00472719; iTF_00554064; iTF_00544881; iTF_01552113; iTF_00608850; iTF_00554739; iTF_00558324; iTF_01557940; iTF_00521013; iTF_00547029; iTF_00477014; iTF_00556886; iTF_01551382; iTF_00542103; iTF_00506520; iTF_00508760; iTF_00587066; iTF_00526972; iTF_00562844; iTF_00585628; iTF_00589916; iTF_00589213; iTF_01553629; iTF_00584095; iTF_01550655; iTF_00519584; iTF_00561408; iTF_01356512; iTF_00803266; iTF_00532772; iTF_01560102; iTF_00537898; iTF_00471275; iTF_01554347; iTF_01549941; iTF_01549240; iTF_00510937; iTF_00479164; iTF_00569374; iTF_01552831; iTF_01321575; iTF_00520293; iTF_00491177; iTF_01323050; iTF_01326058; iTF_01325324; iTF_00551245; iTF_00522606; iTF_00525550; iTF_00522607; iTF_00525551; iTF_00522608; iTF_00525552; iTF_00531349; iTF_01327545; iTF_01323773; iTF_00576008; iTF_00523340; iTF_01556490; iTF_00611063; iTF_00549931; iTF_01558689; iTF_00479842; iTF_00530613; iTF_00534977; iTF_01555100; iTF_01559417; iTF_00582624; iTF_00602248;
90% Identity: iTF_00560705;
80% Identity: iTF_00610306; iTF_00610307; iTF_00593515; iTF_00497808; iTF_00497042; iTF_00497043; iTF_00597814; iTF_00597815; iTF_00521820; iTF_00567200;