Dsia006656.1
Basic Information
- Insect
- Drosophila siamana
- Gene Symbol
- -
- Assembly
- GCA_035047445.1
- Location
- JAWNPP010000020.1:2157180-2157662[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.3e-29 4.5e-26 90.6 15.0 2 70 34 102 33 102 0.98
Sequence Information
- Coding Sequence
- ATGAGTCAAGGATATACACCAGCACAAACCTACCAGCCCGGAGCACCCCAGGTGGTCATACAGACCACGACGACCACGAATGTGGTGCCCATTGGCAGCGAGCCATCGCGAGTGCAGTGTCCATCGTGTCATGCGGATATCCTGACGAACGTGAAGAGAACCCCGACGGGTCGCACTCACTGCTGGGCTCTGATCCTGTGCCTATTCCTCTGCTggccctgtgtgtgtgtgccctaCTGCATGGACTCTTGCCAGAATGCCGAGCACTCGTGCCCCAACTGCGGCGCCTACATCGGCACCTACGAGAACTAA
- Protein Sequence
- MSQGYTPAQTYQPGAPQVVIQTTTTTNVVPIGSEPSRVQCPSCHADILTNVKRTPTGRTHCWALILCLFLCWPCVCVPYCMDSCQNAEHSCPNCGAYIGTYEN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00567201;
- 90% Identity
- iTF_00534977; iTF_00520293; iTF_00563559; iTF_00491177; iTF_00617291; iTF_00551245; iTF_00531349; iTF_00506520; iTF_00589916; iTF_00538626; iTF_01321575; iTF_01326058; iTF_01325324; iTF_00522606; iTF_00525550; iTF_00522607; iTF_00525551; iTF_00522608; iTF_00525552; iTF_01327545; iTF_01323773; iTF_00537898; iTF_00803266; iTF_00532772; iTF_01549941; iTF_00510937; iTF_01558689; iTF_00579650; iTF_00545637; iTF_01557221; iTF_01560102; iTF_00473447; iTF_00534248; iTF_00602248; iTF_01555785; iTF_00509483; iTF_00549931; iTF_01554347; iTF_00544881; iTF_01552113; iTF_00554739; iTF_01557940; iTF_00547029; iTF_00477014; iTF_01551382; iTF_01549240; iTF_00587066; iTF_00526972; iTF_00585628; iTF_00589213; iTF_01553629; iTF_01550655; iTF_01552831; iTF_00519584; iTF_01356512; iTF_00523340; iTF_00608850; iTF_00599970; iTF_00558324; iTF_00584095; iTF_00611063; iTF_00587805; iTF_00471275; iTF_00479164; iTF_00529229; iTF_00472719; iTF_00479842; iTF_00584837; iTF_00554064; iTF_00556886; iTF_00562844; iTF_00521013; iTF_00614572; iTF_00542103; iTF_00547726; iTF_00508760; iTF_01555100; iTF_01559417; iTF_00569374; iTF_00582624; iTF_00513122; iTF_00530613;
- 80% Identity
- -