Dnig003312.1
Basic Information
- Insect
- Drosophila nigritarsus
- Gene Symbol
- -
- Assembly
- GCA_035044305.1
- Location
- JAWNMF010000166.1:4084374-4085084[+]
Transcription Factor Domain
- TF Family
- zf-LITAF-like
- Domain
- zf-LITAF-like domain
- PFAM
- PF10601
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family display a conserved zinc ribbon structure [3] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS)[2]. The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.2e-28 1.2e-25 89.5 17.9 2 70 32 100 31 100 0.97
Sequence Information
- Coding Sequence
- ATGAGTGGATATACACCAGCGCAGACCTACCAGCCCGGAGGACCAGTAATCATACAGACAACGACCACAACGAATGTGGTGCCCATCGGGAGTCATCCATCGCAGGTTCAGTGCCCCTCCTGTCATGCCCATGTCCTGACCAATGTGAAACGTCAGCCCACAGGACGTACACATTGCTTTGCCTTGATGTTGTGCCTATTCCTCTGTTGGCCTTGTGTTTGCTTGCCCTACTGCATGGACTCCTGTCAGAATGCCAATCATTACTGTCCCAACTGTAGCTCCTATATAGGCACCTACGacaattaa
- Protein Sequence
- MSGYTPAQTYQPGGPVIIQTTTTTNVVPIGSHPSQVQCPSCHAHVLTNVKRQPTGRTHCFALMLCLFLCWPCVCLPYCMDSCQNANHYCPNCSSYIGTYDN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00567201;
- 90% Identity
- iTF_00567201; iTF_00610306; iTF_00610307; iTF_00498532; iTF_00542820; iTF_00495526; iTF_00574470; iTF_00574471; iTF_00518824; iTF_00502185; iTF_00528457; iTF_00528458; iTF_00593515; iTF_01328267; iTF_00565036; iTF_00583343; iTF_00599247; iTF_00497808; iTF_00497042; iTF_00559154; iTF_00497043; iTF_00559155; iTF_00553428; iTF_00597813; iTF_00513846; iTF_00570774; iTF_00597814; iTF_00597815; iTF_00482649; iTF_00576729; iTF_00577433; iTF_00607482; iTF_00557563; iTF_00499964; iTF_00521820; iTF_00616573; iTF_00620254; iTF_00517375; iTF_00486240; iTF_00561408; iTF_00567200; iTF_00596320;
- 80% Identity
- -