Ccup021807.1
Basic Information
- Insect
- Ctenicera cuprea
- Gene Symbol
- Ssb-c31a_1
- Assembly
- GCA_958336395.1
- Location
- OY284489.1:16570561-16570957[-]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.53 3.1e+04 -3.8 1.2 32 37 4 9 3 9 0.82 2 2 1.9e-27 1.1e-22 80.9 1.6 1 50 37 86 37 88 0.97
Sequence Information
- Coding Sequence
- atgcCTAAGCATAAGCCCAGTAAGAAAAGCGAATCTTCAGATTCCGATTCTGGACCAGAAGATagaGGACCTTCAAAGAAGCAGAAGGTTCCAGAAGAAGAAAACTCATGGGACTTAGGTAAAAATCGATTCGTCAAGTTATCCGAGTTTAAGGGAAAATGGTACATCAACATTCGTGAGTTTTATGACGCTGGTGGAGAGCTGAAACCTGGAAAAAAGGGTATTATGCTTACCATGGAGCAATGGCAGAAATTCAAGGGCATACTTCCCGAAATTGAAGATGCTATTAAGCAAAATGTGTAG
- Protein Sequence
- MPKHKPSKKSESSDSDSGPEDRGPSKKQKVPEEENSWDLGKNRFVKLSEFKGKWYINIREFYDAGGELKPGKKGIMLTMEQWQKFKGILPEIEDAIKQNV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00271171; iTF_01291587; iTF_00272548; iTF_00272549; iTF_01293712; iTF_00927703; iTF_00268283; iTF_00269819; iTF_00838570; iTF_00788910; iTF_00977999; iTF_00153202; iTF_00151787; iTF_00003762; iTF_00853970; iTF_01517251; iTF_01284549; iTF_01295200;
- 90% Identity
- -
- 80% Identity
- -