Bhed010345.1
Basic Information
- Insect
- Byasa hedistus
- Gene Symbol
- e2f7_1
- Assembly
- GCA_029286795.1
- Location
- JAGSMW010000014.1:6873670-6875392[-]
Transcription Factor Domain
- TF Family
- E2F
- Domain
- E2F_TDP domain
- PFAM
- PF02319
- TF Group
- Helix-turn-helix
- Description
- This family contains the transcription factor E2F and its dimerisation partners TDP1 and TDP2, which stimulate E2F-dependent transcription. E2F binds to DNA as a homodimer or as a heterodimer in association with TDP1/2, the heterodimer having increased binding efficiency. The crystal structure of an E2F4-DP2-DNA complex shows that the DNA-binding domains of the E2F and DP proteins both have a fold related to the winged-helix DNA-binding motif. Recognition of the central c/gGCGCg/c sequence of the consensus DNA-binding site is symmetric, and amino acids that contact these bases are conserved among all known E2F and DP proteins.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 7.2e-23 5.7e-19 68.4 0.1 1 65 52 118 52 118 0.93 2 3 1 7.9e+03 -2.5 0.0 11 29 124 141 123 143 0.70 3 3 6.4e-17 5e-13 49.4 0.1 1 64 153 243 153 244 0.89
Sequence Information
- Coding Sequence
- ATGTATGAGAGTGAATACATAACTTCTACTCCGAAGCGATATGCTCTTACTGAAGTCACAAACGCAAGTTATGTTTCTCCAACTGCTAACCTCAAGTTGTTGACTAATGTTGCACTGCAGTATCCCACGCCGCCACCCAGCGCAGTACATCGGAAAGAAAAATCTTTGCAAATATTATGTGACAAatttctTAACCTATATCCCCTTCAATGCAATGGAACCATGAAAATACAATTGGACAGCACTGCAGCTAGATTGGGTGTAGAAAAGCGCAGAATGTATGatataatcaatatattaGAGGCAATGAAGTATGCAGTccatgaaaagaaaaatacatatttatggcATGGAGAATCGGGCTtgagttcttttttaaaattattgaaaaaacaaGGAGAAAATCTACGTTTGTCTGAAGCCCTAAGAGGTAGGGCACCTAAGCCTCCGCCACCAAAACATAAAACACTTGGAGTTTTGGCAAAAAGatttttgatgttatttttaGTAGAACCACAAAATACTTTAATCAATCTAGAAATGGCTGTGAGGGTACTAATAGACACatctaacaaaaataaaactgatcTCTCACCAGAGCAGCTCGACCGACAACACAAGTCTAAAGTAAGAAGACTCTATGATATAgctaatgtatttatatcaattgGTCTCATAGAAAAAGTTTCTggaaatttgatattaaagaagccagtatttaaatatgtggGGCGGTACAAAGTTAATAAGATTGATGTAACTTCAATTATGACACCATCACCGGTGACACCACTATCTGCTTTAGATATACAACATAAATTAACCCCTTGCCATGTATATGCCGGTAGGTCTCGGCGAAAGTTGGAGTTTACTAAACTGAGTAATGAAGCCAAATTAGGTGTTACCACTCCACCACACACACCATCGCACAAGTGGGATGAGATCCTACTTGTAGCTGATATGGAACTTAACAGAATTAACAATGGAGTTTTCTTGTGA
- Protein Sequence
- MYESEYITSTPKRYALTEVTNASYVSPTANLKLLTNVALQYPTPPPSAVHRKEKSLQILCDKFLNLYPLQCNGTMKIQLDSTAARLGVEKRRMYDIINILEAMKYAVHEKKNTYLWHGESGLSSFLKLLKKQGENLRLSEALRGRAPKPPPPKHKTLGVLAKRFLMLFLVEPQNTLINLEMAVRVLIDTSNKNKTDLSPEQLDRQHKSKVRRLYDIANVFISIGLIEKVSGNLILKKPVFKYVGRYKVNKIDVTSIMTPSPVTPLSALDIQHKLTPCHVYAGRSRRKLEFTKLSNEAKLGVTTPPHTPSHKWDEILLVADMELNRINNGVFL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00967840;
- 90% Identity
- iTF_01176003; iTF_00197167; iTF_01129847; iTF_01143657; iTF_01145094; iTF_01147216; iTF_01149366; iTF_00957754; iTF_01142205; iTF_01141444; iTF_01147901; iTF_01140734; iTF_01148628; iTF_01144350;
- 80% Identity
- -