Aflo021816.1
Basic Information
- Insect
- Aphaenogaster floridana
- Gene Symbol
- Ssb-c31a_1
- Assembly
- GCA_003063835.1
- Location
- NJRP01000033.1:17574-18116[+]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 0.041 1e+03 -0.2 0.1 29 37 16 24 11 24 0.81 2 3 0.35 8.7e+03 -3.2 0.4 30 37 40 47 36 47 0.75 3 3 2.2e-28 5.5e-24 83.9 0.3 1 51 57 108 57 109 0.97
Sequence Information
- Coding Sequence
- ATGCCGAAGTCGAAGGAATATCTGTCTGACACTGATGATAGCAGTGAGGAGGAAGCAAAGCCAAGTAAGAAGAGGCAACAGAAGGAAAAAGATGCAGATGAAGATAAAGCGGCGAAAGACGAAAAGAGACCAGCGAAAAAGGCAAAAACGGATGACGAAGAAACTATTTGGGACTTGGGTAACAATCGTCAAGTGAATGTGAGAAATTTCAGAGGCAAATATTATGTCGACATCCGAGAGATGTATTACGACAAGGATGGCGATTTAAAACCAGGAAAAAAAGGAATATGCTTAACTATGCAACAATGGCGAAAGTTCATGGATGTTGTGGAGGAGGTGGATAAAGTGGCAAAATCAAAGAGTTAG
- Protein Sequence
- MPKSKEYLSDTDDSSEEEAKPSKKRQQKEKDADEDKAAKDEKRPAKKAKTDDEETIWDLGNNRQVNVRNFRGKYYVDIREMYYDKDGDLKPGKKGICLTMQQWRKFMDVVEEVDKVAKSKS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01229030;
- 90% Identity
- iTF_00127466; iTF_00125936; iTF_00128210; iTF_00128985; iTF_00129754;
- 80% Identity
- iTF_00128210; iTF_00128985; iTF_00129754;