Aips015044.1
Basic Information
- Insect
- Agrotis ipsilon
- Gene Symbol
- gprs_1
- Assembly
- GCA_028554685.1
- Location
- CM052969.1:5804617-5808448[+]
Transcription Factor Domain
- TF Family
- BTB
- Domain
- zf-C2H2|ZBTB
- PFAM
- PF00651
- TF Group
- Zinc-Coordinating Group
- Description
- The BTB (for BR-C, ttk and bab) [6] or POZ (for Pox virus and Zinc finger) [1] domain is present near the N-terminus of a fraction of zinc finger (Pfam:PF00096) proteins and in proteins that contain the Pfam:PF01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation [1]. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule [2]. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT [5, 3, 4]. The POZ or BTB domain is also known as BR-C/Ttk or ZiN.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 8.4e-10 4.3e-07 31.1 0.0 9 45 36 73 28 92 0.84 2 2 6e-06 0.0031 18.6 0.0 40 79 116 155 107 160 0.71
Sequence Information
- Coding Sequence
- ATGCGAAGCGGGGCGCTAGCGGCAATGGAGGCGGAGCCTGACCTCAGCACCTTCGAGAACAAGTCAGGGCTGGCAGAGGACATGAAGTTCCTTGCCTCAATGCCCGAACTGTGTGACGTCACCTTCCTGGTGGGGGATACAAGGGAGCCAGTTTGTGCTGTGAAAGCCGTACTAGCTGCAAGGAGCAGAGTATTTCAAAAGATGCTCTACCAAGCTCCCAGTCCTCAGAGGAAGAAGGAACCAGCACCCAGGGAGAACAAACTACGTCTGTTCTTGAAAAGATCTTCGGAGCCCCTGCTCAACCTGCAAAACGCAGCTCAGCAGAGATCGACTTTCGCGCAGCAATTGGCACCAATACAAGAGcCATCATCGCAGCAGCATCAGACATTGATCATTGAAGAGTTTGAACCTGATGTCTTTCGCCAACTGATTGAGTACATTCACACTGGATGCGTGACCCTGCAACCTCGGACTTTGCTTGGTAAGTGA
- Protein Sequence
- MRSGALAAMEAEPDLSTFENKSGLAEDMKFLASMPELCDVTFLVGDTREPVCAVKAVLAARSRVFQKMLYQAPSPQRKKEPAPRENKLRLFLKRSSEPLLNLQNAAQQRSTFAQQLAPIQEPSSQQHQTLIIEEFEPDVFRQLIEYIHTGCVTLQPRTLLGK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00836751;
- 90% Identity
- iTF_00013245;
- 80% Identity
- iTF_00445377; iTF_00712097; iTF_01028482; iTF_00037987; iTF_00834820; iTF_00039013; iTF_00147688; iTF_01527502; iTF_00364209; iTF_00172005; iTF_01340390; iTF_00831403; iTF_01441261; iTF_00784558; iTF_00836751; iTF_00924946; iTF_00931635; iTF_01533237; iTF_00274582; iTF_01119542; iTF_01247286; iTF_00173240; iTF_00446392; iTF_00111833; iTF_01027513; iTF_00973947; iTF_00736764; iTF_00013245; iTF_00667709; iTF_00123547; iTF_00833245; iTF_01031293; iTF_01339102; iTF_01339101; iTF_01076704;