Arep010896.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Acrobasis repandana
Gene Symbol
bs
Assembly
GCA_963576875.1
Location
OY756223.1:3154588-3159311[-]

Transcription Factor Domain

TF Family
SRF
Domain
SRF domain
PFAM
PF00319
TF Group
Helix-turn-helix
Description
Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 4.4e-11 3.8e-07 30.3 0.0 23 48 12 37 10 37 0.98

Sequence Information

Coding Sequence
ATGGTCAACTTTGTCGTGGCAGCCCTACCGCGGGCATACGAACTGTCGACACTGACGGGTACGCAAGTGATGCTACTAGTCGCCTCTGAGACTGGCCACGTTTACACGTTCGCGACGCGGAAACTGCAGCCGATGATCACATCAGACGCGGGCAAGAGGCTCATCCAGACGTGCCTCAACTCGCCCGACCCGCCCACCACCAGCGAGCAGCGGATGGCGGCCACCGGCTTTGAGGAAACCGAGCTGACTTATAACGTAGTTGACGAGGATATGAAGGTGAGGCAATTGGCGTACGGCCCCGCTCAGTATGGCCCCATAGAGCACCATCCAGGGCTGGCGCCGTCACCGCTGCAGCAGTACCACCAACACCCTCCTTGTCCGTCTCCCCTTCCGCTGGGCTCACTAGGACAGCCCTACCCCCACGCGCATCTCTCTCATCCACACATGGCGCACCACCCTCAACGGTAG
Protein Sequence
MVNFVVAALPRAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMITSDAGKRLIQTCLNSPDPPTTSEQRMAATGFEETELTYNVVDEDMKVRQLAYGPAQYGPIEHHPGLAPSPLQQYHQHPPCPSPLPLGSLGQPYPHAHLSHPHMAHHPQR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00790242; iTF_00791175; iTF_00926585; iTF_01546626; iTF_00025222; iTF_00795684; iTF_01437961; iTF_00673482; iTF_01153003; iTF_00970384; iTF_01359729; iTF_00166898; iTF_01082419; iTF_00971348; iTF_00288026; iTF_01438906; iTF_00889193; iTF_00706945; iTF_00660290; iTF_00001155; iTF_00342179; iTF_00649987; iTF_01064643; iTF_00017317; iTF_00831206; iTF_01527206; iTF_00143047; iTF_00851783; iTF_00968007; iTF_01173255; iTF_01197703; iTF_00430632; iTF_00276394; iTF_00869611; iTF_00450093; iTF_00658381; iTF_01205677; iTF_01495022; iTF_01061871; iTF_01203215; iTF_00177104; iTF_01119312; iTF_00666513; iTF_01134769; iTF_01026163; iTF_01166675; iTF_00649076; iTF_00932532; iTF_01031124; iTF_01425044; iTF_01084245; iTF_00834614; iTF_01502070; iTF_00043480; iTF_00289593; iTF_01192697; iTF_00032890; iTF_00041754; iTF_00761658; iTF_00931386; iTF_00345788; iTF_00428988; iTF_00952700; iTF_01245916; iTF_00375197; iTF_00810045; iTF_01063741; iTF_00036703; iTF_00156223; iTF_00206047; iTF_00281311; iTF_00636383; iTF_00150528; iTF_00637632; iTF_00709216; iTF_01085216; iTF_00811009; iTF_01429025; iTF_00361604; iTF_01219750; iTF_00026830; iTF_01528270; iTF_01509585; iTF_01529169; iTF_00686323; iTF_00737460; iTF_00318073; iTF_00638622; iTF_00856606; iTF_00377087; iTF_00632735; iTF_01099811; iTF_00195140; iTF_00696453; iTF_00703943; iTF_00697323; iTF_00698294; iTF_00702880; iTF_00704992; iTF_00284519; iTF_01146184; iTF_01161352; iTF_01508041; iTF_00204330; iTF_01337729; iTF_00162792; iTF_00161525; iTF_00446123; iTF_00661260; iTF_00699148; iTF_00705993; iTF_00275245; iTF_01403409; iTF_00821806; iTF_01222455; iTF_00909690; iTF_00011966; iTF_00325362; iTF_00125107; iTF_01209250; iTF_01172357; iTF_00895920; iTF_01170579; iTF_01182867; iTF_00207893; iTF_00208861; iTF_00447125; iTF_00701045; iTF_00701968; iTF_01336822; iTF_01501092; iTF_00844327; iTF_00119576; iTF_01335914; iTF_00715768; iTF_00840277; iTF_00178137; iTF_01139577; iTF_01171449; iTF_00663059; iTF_00000314; iTF_00277338; iTF_00353050; iTF_00354062; iTF_00662203; iTF_00267163; iTF_00772859; iTF_00680521; iTF_00148445; iTF_00149375; iTF_01140892; iTF_01143805; iTF_01142367; iTF_01145248; iTF_00007991; iTF_00033784; iTF_01545728; iTF_01542945; iTF_01561095; iTF_01543913; iTF_01544860;
90% Identity
iTF_00011966;
80% Identity
-