Vtam007885.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Vanessa tameamea
Gene Symbol
bs
Assembly
GCA_037043105.1
Location
CM073286.1:5601239-5610568[+]

Transcription Factor Domain

TF Family
SRF
Domain
SRF domain
PFAM
PF00319
TF Group
Helix-turn-helix
Description
Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 1 3e-12 1.8e-08 34.1 0.0 22 48 10 36 7 36 0.97

Sequence Information

Coding Sequence
ATGTTTGATTCGTGGCCTGTGAGCTCAAAAGCCTACGAGCTCTCAACCCTAACGGGAACACAGGTGATGCTTCTAGTCGCGTCCGAAACCGGCCACGTGTACACATTCGCAACACGAAAGCTTCAGCCAATGATCACGTCAGATTCAGGAAAGAGATTGATACAGACGTGTCTCAACTCACCGGACCCGCCGACTACCAGCGAGCAGAGAATGGCGGCCACAGGCTTCGAGGAAACGGAGCTCACGTATAACGTTGTAGACGACGATATGAAGGTGAGACAATTGGCGTACGCTGGCTCGCAGTATCCTATAGAACACCACCCGGGTCTCGCCCCATCGCCGTTGCAGCAGTACCATCAACATCCTCCGTGTCCGTCACCCCTACCCCTAAGCTCCTTAGGACAACCTTACTCACACGCACACCTTTCTCACCCCCACATGTCTCACCATCCACAACGGTAG
Protein Sequence
MFDSWPVSSKAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMITSDSGKRLIQTCLNSPDPPTTSEQRMAATGFEETELTYNVVDDDMKVRQLAYAGSQYPIEHHPGLAPSPLQQYHQHPPCPSPLPLSSLGQPYSHAHLSHPHMSHHPQR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00013001;
90% Identity
iTF_01429025; iTF_00361604; iTF_01219750; iTF_01528270; iTF_01509585; iTF_01529169; iTF_00686323; iTF_00737460; iTF_00318073; iTF_00638622; iTF_00856606; iTF_00377087; iTF_00632735; iTF_00700100; iTF_00696453; iTF_00703943; iTF_00697323; iTF_00698294; iTF_00702880; iTF_00704992; iTF_01078184; iTF_00723042; iTF_00001155; iTF_00649987; iTF_01064643; iTF_00017317; iTF_00144550; iTF_01527206; iTF_00143047; iTF_00851783; iTF_00159816; iTF_00778731; iTF_00450093; iTF_00796493; iTF_01156429; iTF_01506318; iTF_00213423; iTF_01061871; iTF_01026163; iTF_00425364; iTF_01031124; iTF_01425044; iTF_01084245; iTF_01080694; iTF_00888247; iTF_00124248; iTF_00642297; iTF_01192697; iTF_00041754; iTF_00212442; iTF_00761658; iTF_00952700; iTF_00375197; iTF_00810045; iTF_01063741; iTF_00036703; iTF_00785183; iTF_01085216; iTF_00038753; iTF_01437027; iTF_01076484; iTF_01181867; iTF_00780998; iTF_00837515; iTF_00878829; iTF_01205677; iTF_01018543; iTF_01203215; iTF_00896788; iTF_00834614; iTF_01401272; iTF_00621209; iTF_00248058; iTF_00836539; iTF_01079037; iTF_00776703; iTF_00667471; iTF_00687855; iTF_00824722; iTF_01264595; iTF_00924661; iTF_00777981; iTF_00809118; iTF_01030206; iTF_00699148; iTF_00705993; iTF_00781804; iTF_00701045; iTF_00701968; iTF_00875285; iTF_00874440; iTF_00876148; iTF_00779479; iTF_00782616; iTF_00457209; iTF_00458026; iTF_00695577; iTF_00985082; iTF_00986075; iTF_00353050; iTF_00354062; iTF_01091908; iTF_00801826; iTF_01091909; iTF_00775997; iTF_00775228;
80% Identity
-