Cnup030199.1
Basic Information
- Insect
- Catocala nupta
- Gene Symbol
- bs
- Assembly
- GCA_963675205.1
- Location
- OY776093.1:6933011-6936121[+]
Transcription Factor Domain
- TF Family
- SRF
- Domain
- SRF domain
- PFAM
- PF00319
- TF Group
- Helix-turn-helix
- Description
- Serum response factor (SRF) is a ubiquitous nuclear protein important for cell proliferation and differentiation. SRF function is essential for transcriptional regulation of numerous growth-factor-inducible genes, such as c-fos oncogene and muscle-specific actin genes. A core domain of around 90 amino acids is sufficient for the activities of DNA-binding, dimerisation and interaction with accessory factors. Within the core is a DNA-binding region, designated the MADS box [2], that is highly similar to many eukaryotic regulatory proteins: among these are MCM1, the regulator of cell type-specific genes in fission yeast; DSRF, a Drosophila trachea development factor; the MEF2 family of myocyte-specific enhancer factors; and the Agamous and Deficiens families of plant homeotic proteins. In SRF, the MADS box has been shown to be involved in DNA-binding and dimerisation [1]. Proteins belonging to the MADS family function as dimers, the primary DNA-binding element of which is an anti-parallel coiled coil of two amphipathic α-helices, one from each subunit. The DNA wraps around the coiled coil allowing the basic N-termini of the helices to fit into the DNA major groove. The chain extending from the helix N-termini reaches over the DNA backbone and penetrates into the minor groove. A 4-stranded, anti-parallel β-sheet packs against the coiled-coil face opposite the DNA and is the central element of the dimerisation interface. The MADS-box domain is commonly found associated with K-box region see (IPR002487).
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.6e-11 4.1e-07 31.1 0.0 22 48 4 30 2 30 0.97
Sequence Information
- Coding Sequence
- ATGTTGATCATGgCATACGAGCTGTCGACCCTGACGGGCACACAAGTGATGTTGCTAGTCGCGTCAGAGACAGGCCACGTATACACTTTCGCGACGCGGAAGCTGCAGCCGATGATCACGTCAGACTCCGGCAAGCGGCTCATCCAGACGTGCCTCAACTCCCCAGATCCGCCCACCACCAGCGAGCAGCGCATGGCGGCGACTGGCTACGAGGAAACAGAGCTCACGTATAACGTAGTAGACGAGGATATGAAGGTGAGGCAATTGGCGTACGCGGGCACTGCGCAGTACCCCATCGACCACCACCCGAGCCTGGCTCCGTCGCCGTTGCAGCAGTACCACCAGCACCCGCCGTGCCCCTCGCCCCTCCCCCTCGGCTCTCTCGGCCAACCGTACTCCCACGCTCACCTCTCCCATCCTCACATGTCCCATCACCCACAACGGTAG
- Protein Sequence
- MLIMAYELSTLTGTQVMLLVASETGHVYTFATRKLQPMITSDSGKRLIQTCLNSPDPPTTSEQRMAATGYEETELTYNVVDEDMKVRQLAYAGTAQYPIDHHPSLAPSPLQQYHQHPPCPSPLPLGSLGQPYSHAHLSHPHMSHHPQR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00013001;
- 90% Identity
- iTF_00683340;
- 80% Identity
- -