Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0077 45 4.2 0.1 22 48 90 116 85 120 0.83

2 4 1.5e-05 0.085 13.0 0.0 21 52 117 148 114 149 0.89

3 4 0.017 96 3.2 0.1 21 48 145 172 143 176 0.85

4 4 4.4e-05 0.26 11.4 0.1 21 47 173 199 169 206 0.88

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0077	45	4.2	0.1	22	48	90	116	85	120	0.83
2	4	1.5e-05	0.085	13.0	0.0	21	52	117	148	114	149	0.89
3	4	0.017	96	3.2	0.1	21	48	145	172	143	176	0.85
4	4	4.4e-05	0.26	11.4	0.1	21	47	173	199	169	206	0.88

Coding Sequence: ATGATGCATATCAAGAGCCTGCCACACGCACATCAGGCCGCTGCGGCAATGAGCAATTGTGACATTGTCATTCCAACATCAGCCCCGCCACCGCCAACATCGCATACACTGGCTCATCTTGTGGCCAACGCGACCCACAGTCCGACAACACTCACCGGGGACGCGCACTACGTGAGCAACGGTCACTCCGGCAACGATCATGTCGGCGAGGGTAATGGGTCGAGCAGCAGTGGTGGCGGCGGCGGTGGTGGTGGTGGCCGAGAACAGGATAAGCCGTTCCATTGTACTGTTTGCGATAGACGCTTCAGGCAACTGAGCACACTAACCAACCATGTGAAAATCCATACCGGGGAAAAGCCCTATAAATGCAACGTTTGTGATAAGACGTTCCGTCAATCGTCAACTTTGACGAATCATCTGAAAATTCATACGGGCGAAAAGCCTTACAATTGCAACTATTGTCCCAAGCATTTCCGTCAGCTGAGCACACTGGCCAATCATGTCAAGATTCATACGGGTGAAAAGCCGTTCGAGTGCGTCATATGCAAGAAACAATTCCGGCAATCCAGCACGCTCAACAATCACATAAAGATCCATGTCATGGACAAGGTCTACGTTCCTGTGAAGATCAAAACCGAGGAGGACGAGGGGTGA
Protein Sequence: MMHIKSLPHAHQAAAAMSNCDIVIPTSAPPPPTSHTLAHLVANATHSPTTLTGDAHYVSNGHSGNDHVGEGNGSSSSGGGGGGGGGREQDKPFHCTVCDRRFRQLSTLTNHVKIHTGEKPYKCNVCDKTFRQSSTLTNHLKIHTGEKPYNCNYCPKHFRQLSTLANHVKIHTGEKPFECVICKKQFRQSSTLNNHIKIHVMDKVYVPVKIKTEEDEG

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01551375;
90% Identity: iTF_01557770; iTF_01551375; iTF_01551209; iTF_01549074; iTF_01549232;
80% Identity: iTF_01557770;