Xxan047471.1
Basic Information
- Insect
- Xestia xanthographa
- Gene Symbol
- Runx3
- Assembly
- GCA_905147715.1
- Location
- LR990660.1:20417932-20418360[-]
Transcription Factor Domain
- TF Family
- Runt
- Domain
- Runt domain
- PFAM
- PF00853
- TF Group
- Beta-Scaffold Factors
- Description
- The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.4e-52 4.2e-48 164.2 0.0 3 94 50 141 48 142 0.97
Sequence Information
- Coding Sequence
- ATGTGTAGCACGCAGCGCGCGCGGGTGTCGAGGATGCACCTGACGGGCGCCAGTAGCGGCGCCGTGTCGCCCGACACCAGCTCCTCGCTGCTGCACGAGACCTACACCAAGATGACGTCCGACATCCTCGCGGAGCGGACGCTGGGGGACTTCCTGTCGGAGCACCCGGGCGAGCTGGTGCGGACGGGCAGCCCGCACTTCGTGTGTACAGTGTTGCCTCCGCACTGGCGATCAAACAAAACCCTGCCGGTGGCGTTCAAAGTGGTAGCTCTAGGCGACGTCGGCGACGGAACCCTCGTCACCGTGAGAGCCGGCAACGACGAGAACTGCTGCGCGGAGCTGAGGAACAGCTCTGCGGTGATGAAGAACCAGGTCGCCAAGTTTAACGACTTGCGATTCGTCGGCCGCAGCGGTCGCGGTGAGTGCTGA
- Protein Sequence
- MCSTQRARVSRMHLTGASSGAVSPDTSSSLLHETYTKMTSDILAERTLGDFLSEHPGELVRTGSPHFVCTVLPPHWRSNKTLPVAFKVVALGDVGDGTLVTVRAGNDENCCAELRNSSAVMKNQVAKFNDLRFVGRSGRGEC*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00826598;
- 90% Identity
- iTF_00449895;
- 80% Identity
- iTF_01027073; iTF_01532801; iTF_00737250; iTF_01028034; iTF_00038467; iTF_00147075; iTF_00711587; iTF_01063523; iTF_00907652; iTF_00042407; iTF_01029927; iTF_01525704; iTF_00120265; iTF_01219561; iTF_00446890; iTF_00036398; iTF_00924366; iTF_01084910; iTF_01230286; iTF_00039567; iTF_00928432; iTF_01094672; iTF_01533712; iTF_00364690; iTF_00906834; iTF_01025746; iTF_00444883; iTF_01084019; iTF_01439668; iTF_00685205; iTF_00043254; iTF_00887990; iTF_00040567; iTF_00745399; iTF_00448792; iTF_00622584; iTF_01064408; iTF_00237241; iTF_00757913; iTF_00856377; iTF_00363802; iTF_00667131; iTF_01030907; iTF_00830940; iTF_01428828; iTF_01440764; iTF_01531740; iTF_00905887; iTF_01028991; iTF_00172503; iTF_00445885;