Xrho018422.1
Basic Information
- Insect
- Xestia rhomboidea
- Gene Symbol
- -
- Assembly
- GCA_963853795.1
- Location
- OY970770.1:12179755-12193004[+]
Transcription Factor Domain
- TF Family
- AF-4
- Domain
- AF-4 domain
- PFAM
- PF05110
- TF Group
- Unclassified Structure
- Description
- This family consists of AF4 (Proto-oncogene AF4) and FMR2 (Fragile X syndrome) nuclear proteins. These proteins have been linked to human diseases such as acute lymphoblastic leukaemia and mental disabilities [1]. The family also contains a Drosophila AF4 protein homologue Lilliputian which contains an AT-hook domain. Lilliputian represents a novel pair-rule gene that acts in cytoskeleton regulation, segmentation and morphogenesis in Drosophila [2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5e-12 1.9e-07 31.8 0.0 4 76 46 120 44 133 0.85
Sequence Information
- Coding Sequence
- ATGGAAGTGACAACTTCCGACGTCTATCGACATGAAATCGGCTTGAGCCGGTCAGAAAGGTACGACAAGTGGGACCGGGACAGGGGCGGGGGGAgcggcggcgggggcggcgggtCAGGCGCGTGGGCTGGCCGCGACCGCGAACGCGACCGCGAGCGCGAGCGGCAGGCGCGCGCGCACCAGATGTCGCAGGCGCACGCCGCCGAACCCGACGCATCGTCGCTCTTCCCGGCGCCGTTCAGGGTGTCCGGCAGGCAGGATCGCGTGAGTCAGCAGATCCAGACCAAGCTCGGCGACTACCATCTAGCGCAGTGGTTCATCGATGACCCCAGCAAATCCATCGGGATCTGCGCTGAACCACCAAGTCCTGCACCATGTAAGTACTACCTACATTATCACAAGGAGCCTTAG
- Protein Sequence
- MEVTTSDVYRHEIGLSRSERYDKWDRDRGGGSGGGGGGSGAWAGRDRERDRERERQARAHQMSQAHAAEPDASSLFPAPFRVSGRQDRVSQQIQTKLGDYHLAQWFIDDPSKSIGICAEPPSPAPCKYYLHYHKEP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00685453;
- 90% Identity
- iTF_01061904;
- 80% Identity
- -