Tpre000241.1
Basic Information
- Insect
- Trichogramma pretiosum
- Gene Symbol
- -
- Assembly
- GCA_000599845.3
- Location
- NW:237024-239072[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 6.5 2.7e+03 -1.9 0.1 14 42 152 176 143 183 0.57 2 6 3.1 1.3e+03 -0.9 0.0 27 48 189 210 186 212 0.87 3 6 0.0013 0.55 9.9 0.0 26 45 244 263 241 270 0.91 4 6 0.029 12 5.6 0.0 26 45 271 290 267 298 0.90 5 6 0.36 1.5e+02 2.1 0.0 26 48 298 320 295 324 0.90 6 6 0.093 39 4.0 0.0 26 48 326 348 322 348 0.94
Sequence Information
- Coding Sequence
- ATGGACTTCAGTGATGTATATAACTCtgatgtcagAGTGAAGAAGGAACCAGATGATGTTTccccaattaaaaatgaagattataaGATAATTGACAATGCATGCGATGCTAAAAACGACGAATTCTCGAGtttttgtcgagaaaatttaATTTATGGGCttcgtaaaaataaagaaaattctgAACCTAATAACGATTTGGAAATAGAATTCGAATGTAAGAACGAGAAGCTCGGCATTAACTTATTAGTAGTCAAGAAAATCGAGGACGACTGTCCAGATCAATGGCagcatatgaaaaatagttgcgATTATCAGACtccaaagaaaattaaagaagaaattgtcgACGAAGTAAAAGAGGAATTGAATTTGGATGGTGAACTCAGTGATGCATttgatgcaaatgaaaaaacatttgctcaaaATAGTCAACGCAAAACCCAAACTAATAAGGCACGCAATCGTACCAAAtatccatgtaatatatgcggtaAAAAACTTGCACGAAAAGATTATCTCAagattcacatcgatgcaatTCATAACGGTATTAAACATGAGTGTGgtatatgtggaaagacattcacacaaaaaggaaggctcaaaattcacatcgatgcgatgcataaaggTATAGCACGTACTTGCGAAatgtgcggaaagaaattctcaaccAAGGCTCAACTCAAGATCCACATcgatggagtacataatggtgttaaacatgcgtgtggtatatgtgaaaagacattcacacaaaaaagaGATCTCAAGAGGCATATCGAGggacataatggtgttaaacatgcgtgcggtatatgtgaaaagacattcacacaaaaaggagATCTCAAGAGGCATATCGAGggacataatggtgttaagcATGCGTGTGGTCTATGTGCAAAGACTTTCACACAAAAACGTTATCTcaagattcacatcgatgcgatgcataaaggTGTGGTACATACTTGCGAAgtgtgcggaaagacattcacactaaagggtaatcttaaaaaacacataaatttGATGCATTAA
- Protein Sequence
- MDFSDVYNSDVRVKKEPDDVSPIKNEDYKIIDNACDAKNDEFSSFCRENLIYGLRKNKENSEPNNDLEIEFECKNEKLGINLLVVKKIEDDCPDQWQHMKNSCDYQTPKKIKEEIVDEVKEELNLDGELSDAFDANEKTFAQNSQRKTQTNKARNRTKYPCNICGKKLARKDYLKIHIDAIHNGIKHECGICGKTFTQKGRLKIHIDAMHKGIARTCEMCGKKFSTKAQLKIHIDGVHNGVKHACGICEKTFTQKRDLKRHIEGHNGVKHACGICEKTFTQKGDLKRHIEGHNGVKHACGLCAKTFTQKRYLKIHIDAMHKGVVHTCEVCGKTFTLKGNLKKHINLMH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01485031;
- 90% Identity
- iTF_01485031;
- 80% Identity
- iTF_01485031;