Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 6.5 2.7e+03 -1.9 0.1 14 42 152 176 143 183 0.57

2 6 3.1 1.3e+03 -0.9 0.0 27 48 189 210 186 212 0.87

3 6 0.0013 0.55 9.9 0.0 26 45 244 263 241 270 0.91

4 6 0.029 12 5.6 0.0 26 45 271 290 267 298 0.90

5 6 0.36 1.5e+02 2.1 0.0 26 48 298 320 295 324 0.90

6 6 0.093 39 4.0 0.0 26 48 326 348 322 348 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	6.5	2.7e+03	-1.9	0.1	14	42	152	176	143	183	0.57
2	6	3.1	1.3e+03	-0.9	0.0	27	48	189	210	186	212	0.87
3	6	0.0013	0.55	9.9	0.0	26	45	244	263	241	270	0.91
4	6	0.029	12	5.6	0.0	26	45	271	290	267	298	0.90
5	6	0.36	1.5e+02	2.1	0.0	26	48	298	320	295	324	0.90
6	6	0.093	39	4.0	0.0	26	48	326	348	322	348	0.94

Coding Sequence: ATGGACTTCAGTGATGTATATAACTCtgatgtcagAGTGAAGAAGGAACCAGATGATGTTTccccaattaaaaatgaagattataaGATAATTGACAATGCATGCGATGCTAAAAACGACGAATTCTCGAGtttttgtcgagaaaatttaATTTATGGGCttcgtaaaaataaagaaaattctgAACCTAATAACGATTTGGAAATAGAATTCGAATGTAAGAACGAGAAGCTCGGCATTAACTTATTAGTAGTCAAGAAAATCGAGGACGACTGTCCAGATCAATGGCagcatatgaaaaatagttgcgATTATCAGACtccaaagaaaattaaagaagaaattgtcgACGAAGTAAAAGAGGAATTGAATTTGGATGGTGAACTCAGTGATGCATttgatgcaaatgaaaaaacatttgctcaaaATAGTCAACGCAAAACCCAAACTAATAAGGCACGCAATCGTACCAAAtatccatgtaatatatgcggtaAAAAACTTGCACGAAAAGATTATCTCAagattcacatcgatgcaatTCATAACGGTATTAAACATGAGTGTGgtatatgtggaaagacattcacacaaaaaggaaggctcaaaattcacatcgatgcgatgcataaaggTATAGCACGTACTTGCGAAatgtgcggaaagaaattctcaaccAAGGCTCAACTCAAGATCCACATcgatggagtacataatggtgttaaacatgcgtgtggtatatgtgaaaagacattcacacaaaaaagaGATCTCAAGAGGCATATCGAGggacataatggtgttaaacatgcgtgcggtatatgtgaaaagacattcacacaaaaaggagATCTCAAGAGGCATATCGAGggacataatggtgttaagcATGCGTGTGGTCTATGTGCAAAGACTTTCACACAAAAACGTTATCTcaagattcacatcgatgcgatgcataaaggTGTGGTACATACTTGCGAAgtgtgcggaaagacattcacactaaagggtaatcttaaaaaacacataaatttGATGCATTAA
Protein Sequence: MDFSDVYNSDVRVKKEPDDVSPIKNEDYKIIDNACDAKNDEFSSFCRENLIYGLRKNKENSEPNNDLEIEFECKNEKLGINLLVVKKIEDDCPDQWQHMKNSCDYQTPKKIKEEIVDEVKEELNLDGELSDAFDANEKTFAQNSQRKTQTNKARNRTKYPCNICGKKLARKDYLKIHIDAIHNGIKHECGICGKTFTQKGRLKIHIDAMHKGIARTCEMCGKKFSTKAQLKIHIDGVHNGVKHACGICEKTFTQKRDLKRHIEGHNGVKHACGICEKTFTQKGDLKRHIEGHNGVKHACGLCAKTFTQKRYLKIHIDAMHKGVVHTCEVCGKTFTLKGNLKKHINLMH

Sequence clustering based on sequence similarity using MMseqs2