Basic Information

Gene Symbol
-
Assembly
GCA_000599845.3
Location
NW:237024-239072[+]

Transcription Factor Domain

TF Family
zf-BED
Domain
zf-BED domain
PFAM
PF02892
TF Group
Zinc-Coordinating Group
Description
The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 7 0.0025 0.18 11.3 1.9 12 29 154 171 141 187 0.79
2 7 0.022 1.6 8.3 1.6 16 43 186 210 174 211 0.82
3 7 0.28 21 4.7 0.9 18 29 216 227 212 243 0.74
4 7 0.071 5.3 6.6 0.8 18 39 244 262 239 270 0.83
5 7 0.18 13 5.4 2.1 18 39 271 289 265 299 0.77
6 7 2.7 2e+02 1.6 2.0 17 38 297 315 285 321 0.73
7 7 0.099 7.4 6.2 3.6 16 43 324 348 310 348 0.84

Sequence Information

Coding Sequence
ATGGACTTCAGTGATGTATATAACTCtgatgtcagAGTGAAGAAGGAACCAGATGATGTTTccccaattaaaaatgaagattataaGATAATTGACAATGCATGCGATGCTAAAAACGACGAATTCTCGAGtttttgtcgagaaaatttaATTTATGGGCttcgtaaaaataaagaaaattctgAACCTAATAACGATTTGGAAATAGAATTCGAATGTAAGAACGAGAAGCTCGGCATTAACTTATTAGTAGTCAAGAAAATCGAGGACGACTGTCCAGATCAATGGCagcatatgaaaaatagttgcgATTATCAGACtccaaagaaaattaaagaagaaattgtcgACGAAGTAAAAGAGGAATTGAATTTGGATGGTGAACTCAGTGATGCATttgatgcaaatgaaaaaacatttgctcaaaATAGTCAACGCAAAACCCAAACTAATAAGGCACGCAATCGTACCAAAtatccatgtaatatatgcggtaAAAAACTTGCACGAAAAGATTATCTCAagattcacatcgatgcaatTCATAACGGTATTAAACATGAGTGTGgtatatgtggaaagacattcacacaaaaaggaaggctcaaaattcacatcgatgcgatgcataaaggTATAGCACGTACTTGCGAAatgtgcggaaagaaattctcaaccAAGGCTCAACTCAAGATCCACATcgatggagtacataatggtgttaaacatgcgtgtggtatatgtgaaaagacattcacacaaaaaagaGATCTCAAGAGGCATATCGAGggacataatggtgttaaacatgcgtgcggtatatgtgaaaagacattcacacaaaaaggagATCTCAAGAGGCATATCGAGggacataatggtgttaagcATGCGTGTGGTCTATGTGCAAAGACTTTCACACAAAAACGTTATCTcaagattcacatcgatgcgatgcataaaggTGTGGTACATACTTGCGAAgtgtgcggaaagacattcacactaaagggtaatcttaaaaaacacataaatttGATGCATTAA
Protein Sequence
MDFSDVYNSDVRVKKEPDDVSPIKNEDYKIIDNACDAKNDEFSSFCRENLIYGLRKNKENSEPNNDLEIEFECKNEKLGINLLVVKKIEDDCPDQWQHMKNSCDYQTPKKIKEEIVDEVKEELNLDGELSDAFDANEKTFAQNSQRKTQTNKARNRTKYPCNICGKKLARKDYLKIHIDAIHNGIKHECGICGKTFTQKGRLKIHIDAMHKGIARTCEMCGKKFSTKAQLKIHIDGVHNGVKHACGICEKTFTQKRDLKRHIEGHNGVKHACGICEKTFTQKGDLKRHIEGHNGVKHACGLCAKTFTQKRYLKIHIDAMHKGVVHTCEVCGKTFTLKGNLKKHINLMH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2