Tpre003220.1
Basic Information
- Insect
- Trichogramma pretiosum
- Gene Symbol
- -
- Assembly
- GCA_000599845.3
- Location
- NW:356331-358250[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 10 1.9 7.8e+02 -0.2 0.0 27 48 163 184 149 187 0.87 2 10 0.037 15 5.2 0.0 26 45 218 237 215 244 0.91 3 10 0.19 79 3.0 0.0 26 47 245 266 242 272 0.88 4 10 0.036 15 5.3 0.0 26 45 273 292 269 299 0.91 5 10 0.088 36 4.1 0.1 26 48 300 322 295 329 0.91 6 10 8.3 3.4e+03 -2.3 0.0 26 48 328 350 321 352 0.78 7 10 0.036 15 5.3 0.0 26 45 356 375 351 382 0.91 8 10 0.087 36 4.1 0.0 26 48 383 405 378 411 0.91 9 10 9.5 4e+03 -2.5 0.0 26 46 411 431 406 434 0.76 10 10 0.1 43 3.8 0.0 26 48 467 489 457 491 0.90
Sequence Information
- Coding Sequence
- atggacttcagtgatgtatataactctgatgtcagAGTGAAGAAGGAACCAGATGATGTTTccccaattaaaaatgaagattataaGATAATTGACAATGCATGCGATGCTAAAAACGACGAATTCTCGAGtttttgtcgagaaaatttaATTTATGGGCTTCGTGAAAATGATAACAATTCTGGTCCTAATAACGATTTGGAAATAGAATTCGAATGTAAGGACGAGAAGCTCGGCATTAACTTATTAGTAGTCAAGAAAATCGAGGACGATTATCCAGATCAATGGCAGTCTAAGAAAAATAGTTGCGATTATCagactcaaaagaaaattaaagaagaaatggTCGACGAAGTAAAAGAGGAATTGAATTTGGATGGTGAACTCAGTGATGCATttgatgcaaatgaaaaaacatttgctcaaaATAGTCAACGCAAAACCCAAACTGATAAGGCAATCGTACACAATCGTACCAAAtatccatgtaatatatgcggtaaaaaatttgcacgagAAAATAATCTCAAGgtccacatcgatgcgatgcataatggtatggcacctaaatgcaaaatatgtgaaaagacattcacaggAAAAGGAGATCTCAAGATTCACATCTatggagtacataatggtgttagacATGCATGTAgtatatgtgaaaagacattcacacaaaaaggagATCTCAAGAGGCATATCGAGggacataatggtgttaaacatacGTGTGGTATATGTGCAAAGATATTCGCACATAAAGgaaatctcaaaattcacatcgatggagtacataatggtgttagacATGCGTGTAgtatatgtgaaaagacattcacacaaaaaggagATCTCAAGAGGCATATCGAGggacataatggtgttaaacatacGTGTGGTATATGTGCAAAAATATTCGCACATAAAGgaaatctcaaaattcacatcgatgcgatgcataatggtatggcccctacttgcgaagtatgcggaaagaaatttcaaacgaagaATAAACTCAAGATCCATATCgatgcagtacataatggtgttagacATGCGTGTAgtatatgtgaaaagacattcacacaaaaaggagATCTCAAGAGGCATATCGAGggacataatggtgttaaacatacGTGTGGTATATGTGCAAAAATATTCGCACATAAAGgaaatctcaaaattcacatcgatgcgatgcataatggtatggcccctacttgcgaagtatgcggaaaaaaatttcaaacgaagaATAAACTCAAGATCCATATCgatgcagtacataatggtgttaaacatccatgtaatatatgcggtcaaaaattttcactaaaAGGTAATCTCAAGATCCATATCGATGGAGTACATAgtggtgttaaacatgcgtgtggtatatgtgaaaagacattcacactaaagggtaatcttaaaaaacacatgaatTTGATACATAATAAGACATAA
- Protein Sequence
- MDFSDVYNSDVRVKKEPDDVSPIKNEDYKIIDNACDAKNDEFSSFCRENLIYGLRENDNNSGPNNDLEIEFECKDEKLGINLLVVKKIEDDYPDQWQSKKNSCDYQTQKKIKEEMVDEVKEELNLDGELSDAFDANEKTFAQNSQRKTQTDKAIVHNRTKYPCNICGKKFARENNLKVHIDAMHNGMAPKCKICEKTFTGKGDLKIHIYGVHNGVRHACSICEKTFTQKGDLKRHIEGHNGVKHTCGICAKIFAHKGNLKIHIDGVHNGVRHACSICEKTFTQKGDLKRHIEGHNGVKHTCGICAKIFAHKGNLKIHIDAMHNGMAPTCEVCGKKFQTKNKLKIHIDAVHNGVRHACSICEKTFTQKGDLKRHIEGHNGVKHTCGICAKIFAHKGNLKIHIDAMHNGMAPTCEVCGKKFQTKNKLKIHIDAVHNGVKHPCNICGQKFSLKGNLKIHIDGVHSGVKHACGICEKTFTLKGNLKKHMNLIHNKT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01485168;
- 90% Identity
- iTF_01485168;
- 80% Identity
- iTF_01485168;