Ttro006679.1
Basic Information
- Insect
- Trachelus troglodyta
- Gene Symbol
- Sub1
- Assembly
- GCA_030142635.1
- Location
- JARQTJ010000420.1:2299651-2300226[-]
Transcription Factor Domain
- TF Family
- PC4
- Domain
- PC4 domain
- PFAM
- PF02229
- TF Group
- Unclassified Structure
- Description
- This domain is found at the C-terminal end of Activated RNA polymerase II transcriptional coactivator p15 from humans, YdbC from Lactococcus lactis, and other PC4 family members. p15 has a bipartite structure composed of an N-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [1-4]. Activity is controlled by protein kinases that target the regulatory domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.31 6.1e+03 -3.0 0.9 27 37 36 46 32 46 0.70 2 2 6e-28 1.2e-23 82.5 0.3 1 51 59 110 59 111 0.96
Sequence Information
- Coding Sequence
- ATGCCGAAGTCAAAGGCATATGTCTCAAGCTCATCATCCAGTTACGATACTGACGAGGAAGTAAAGGAAGAAACTTCTAAGAAAAACAGCAAGAGGAAAataccagaaaaaaaagaaaagcctgCACCAAGTAAAAAGGCAAAGCAAGAACcagatgaagatgaagatccAATTTGGGAATTAGGAAACAATCGACGAGTGACTGTGCGTGAATTTAAGGGGAATATGTATGTCGACATCAGAGAGATGTATCTCGATAAAAGTGGAGACATGAAACCAGGAAAGAAAGGTATAGCACTCAACATGGTCCAATggagaaaatttgtttcccTCGTTGAAGAAGTTGACCGTGTTGCTAAGTCCAAGTGTTAA
- Protein Sequence
- MPKSKAYVSSSSSSYDTDEEVKEETSKKNSKRKIPEKKEKPAPSKKAKQEPDEDEDPIWELGNNRRVTVREFKGNMYVDIREMYLDKSGDMKPGKKGIALNMVQWRKFVSLVEEVDRVAKSKC
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00292959;
- 90% Identity
- iTF_01473937; iTF_01473190; iTF_00253579; iTF_01474699; iTF_00252082; iTF_00255092; iTF_00296792; iTF_00297563; iTF_00252828; iTF_00254336;
- 80% Identity
- -