Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.0063 1.1e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 4 0.75 1.3e+04 -4.1 0.8 12 14 33 35 32 35 0.77

3 4 6.3e-11 1.1e-06 28.1 3.7 4 21 54 71 52 72 0.92

4 4 0.11 2e+03 -1.5 4.6 10 15 82 87 81 88 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.0063	1.1e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	4	0.75	1.3e+04	-4.1	0.8	12	14	33	35	32	35	0.77
3	4	6.3e-11	1.1e-06	28.1	3.7	4	21	54	71	52	72	0.92
4	4	0.11	2e+03	-1.5	4.6	10	15	82	87	81	88	0.83

Coding Sequence: ATGTCTGATGATGGATCAACCGTTGTGGAGAAGAAGGGCCGTGGTAGGCCCAAAGCGAACGGAACCCAAGCTGAGGCTAAAGTGGAAACAAAAAAGAGGGGCCGAACTCCAGTAGCAGCTAAGCCAGCTAAAGAATCTGCAAAGTCATCTGATGATGAACAGGCACCGACAGCCAAGAGAGGGCGTGGCAGGCCTAAGGGCTCCAAAAAGAAGACTTCTGCTAAGGGAAAGGCCGGAGAATCCAGGGGACGTGGACGCCCACGCAAGGACACCGCTCCAAAGAAGGATGCTGCCTCCACTGAAGAGGAGCAAGATGATGATGAGGATGATGAAGGTTCTGATCAGTAG
Protein Sequence: MSDDGSTVVEKKGRGRPKANGTQAEAKVETKKRGRTPVAAKPAKESAKSSDDEQAPTAKRGRGRPKGSKKKTSAKGKAGESRGRGRPRKDTAPKKDAASTEEEQDDDEDDEGSDQ

Sequence clustering based on sequence similarity using MMseqs2