Basic Information

Gene Symbol
-
Assembly
GCA_947458855.1
Location
OX375848.1:15447329-15447980[-]

Transcription Factor Domain

TF Family
HMGA
Domain
HMGA domain
PFAM
AnimalTFDB
TF Group
Unclassified Structure
Description
This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 4 0.001 40 5.1 0.8 11 16 13 18 11 23 0.86
2 4 1 3.9e+04 -5.0 1.4 12 14 33 35 33 35 0.91
3 4 1.4e-10 5.6e-06 27.0 1.9 4 21 54 71 52 72 0.90
4 4 0.11 4.5e+03 -1.5 4.6 10 15 82 87 81 88 0.83

Sequence Information

Coding Sequence
ATGTCCGATGATGGCTCCACTGTTGTTGAGAAGAAAGGTCGCGGCAGGCCGAAAGCTAATGGTACCCAAAACGAAGCAAAAGCTGACACAAAAAAAAGGGGAAGAACCCCCGTCACTGCTAAACCTGTAAAAGAAACTGCAAAGTCTTCCGATGATGAGCAGGCACCAGCAGCTAAACGAGGGCGTGGCAGACCCAAGGGCTCCAAGAAGAAGGCAGCGGCTTCCAAAGGAAAGGGTGAAGCACGAGGTCGTGGCCGTCCCCGCAAGGATGCCCCTCCCAAAAAGGATGCTTCTTCAGAAGAAGAGCAAGATGATGATGATGATGAAGAGGGTTCAGACCAGTAA
Protein Sequence
MSDDGSTVVEKKGRGRPKANGTQNEAKADTKKRGRTPVTAKPVKETAKSSDDEQAPAAKRGRGRPKGSKKKAAASKGKGEARGRGRPRKDAPPKKDASSEEEQDDDDDEEGSDQ

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

90% Identity
-
80% Identity
-