Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.19 35 4.3 0.1 21 46 27 52 21 57 0.89

2 8 3.4 6.1e+02 0.3 0.0 26 45 60 79 54 86 0.77

3 8 0.071 13 5.7 0.1 22 46 84 108 79 114 0.86

4 8 0.0041 0.75 9.6 0.0 22 46 112 136 107 142 0.85

5 8 0.095 17 5.3 0.0 22 47 140 165 135 171 0.85

6 8 0.1 19 5.1 0.0 22 46 168 192 163 198 0.85

7 8 0.1 18 5.2 0.1 22 46 196 220 191 226 0.89

8 8 0.14 25 4.8 0.3 26 45 228 247 222 251 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.19	35	4.3	0.1	21	46	27	52	21	57	0.89
2	8	3.4	6.1e+02	0.3	0.0	26	45	60	79	54	86	0.77
3	8	0.071	13	5.7	0.1	22	46	84	108	79	114	0.86
4	8	0.0041	0.75	9.6	0.0	22	46	112	136	107	142	0.85
5	8	0.095	17	5.3	0.0	22	47	140	165	135	171	0.85
6	8	0.1	19	5.1	0.0	22	46	168	192	163	198	0.85
7	8	0.1	18	5.2	0.1	22	46	196	220	191	226	0.89
8	8	0.14	25	4.8	0.3	26	45	228	247	222	251	0.89

Coding Sequence: ATGGGTCACGACTGTCCAGTGTGCGGCAAGAAAAATGAGTCCGCGTCCAACCAGGTTGTGCACCTGCGGACCCACACGggagagaagccttttgagtgcacggtttgcaacaagaagttcagccAACGTAGCCAGCTCAAACCGCACCTCCGAATCCATACGGGAGAGAAGCTCTTTGAGTGCATGGTTTGCAGCAAGAGGTTCAGCGAAGGTGGCGACCTCAGAAAGCATCTCCGGACCCACTTAGGAGACAAGCCCTTTCAGTGCACaatttgcaacaagaagttcatcCAAGGTGGTCATCTCAGAGCGCATCTCCGAACCCACACAGGAGACAAGCCCTTAGAGTGCGCGGTTTGTAACAAGAAGTTCATCCAAAGTGGCGACCTCAGAAAGCATCTCCGGACCCACACAGGGGACaagccttttgagtgcacggtttgcaacaagaagttcagccAAGGTGGCAGCCTCAGAACGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggtttgcaacaagaagttcagccAAGGTGGCAGCCTCAGAACGCATCTCCGGACCCACACAGGAGAcaagccctttgagtgcacggTTTGCATCAAGAAGTTCACCAGAAGTGACAGCCTCAGAGTGCATCTCCGGATCCACACAGGAGACAAGCGCTTTGAGTGCGCGGTTTGCAGCAAGAGGTTCAGGCAAAACTctcatctgaaaaagcatctGCGAACCCACACTCAAGGACACGATTTGAACATCCAGTCGGCAAACAGGCGTTAA
Protein Sequence: MGHDCPVCGKKNESASNQVVHLRTHTGEKPFECTVCNKKFSQRSQLKPHLRIHTGEKLFECMVCSKRFSEGGDLRKHLRTHLGDKPFQCTICNKKFIQGGHLRAHLRTHTGDKPLECAVCNKKFIQSGDLRKHLRTHTGDKPFECTVCNKKFSQGGSLRTHLRTHTGDKPFECTVCNKKFSQGGSLRTHLRTHTGDKPFECTVCIKKFTRSDSLRVHLRIHTGDKRFECAVCSKRFRQNSHLKKHLRTHTQGHDLNIQSANRR

Sequence clustering based on sequence similarity using MMseqs2