Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.1 18 5.2 0.1 21 49 27 55 22 58 0.86

2 8 0.004 0.74 9.7 0.0 21 46 55 80 47 86 0.82

3 8 0.13 23 4.9 0.0 22 47 84 109 79 116 0.85

4 8 9.2 1.7e+03 -1.1 0.0 22 46 112 136 108 142 0.76

5 8 0.046 8.4 6.3 0.0 22 45 140 163 131 166 0.89

6 8 0.1 19 5.1 0.0 21 46 167 192 163 198 0.85

7 8 0.11 19 5.1 0.0 22 52 196 226 191 227 0.85

8 8 0.37 67 3.4 0.2 22 45 224 247 221 251 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.1	18	5.2	0.1	21	49	27	55	22	58	0.86
2	8	0.004	0.74	9.7	0.0	21	46	55	80	47	86	0.82
3	8	0.13	23	4.9	0.0	22	47	84	109	79	116	0.85
4	8	9.2	1.7e+03	-1.1	0.0	22	46	112	136	108	142	0.76
5	8	0.046	8.4	6.3	0.0	22	45	140	163	131	166	0.89
6	8	0.1	19	5.1	0.0	21	46	167	192	163	198	0.85
7	8	0.11	19	5.1	0.0	22	52	196	226	191	227	0.85
8	8	0.37	67	3.4	0.2	22	45	224	247	221	251	0.89

Coding Sequence: ATGGGTCACGTCTGTCGAGTGTGCGGCAAGAAGAATGAGTCCGCGTCCAAGCTGGTTGTGCACCTGCGGACCCACACgggggagaagccttttgagtgcacggtttgcaacaagaagttcagccAACGTAGCCAGCTCAAACCGCACCTCCGAATCCACACAGGAGAGAAGCCCTTCGAGTGcacggtttgcaacaagaagttcaacCAAGGTGGCGACCTCAGAAAGCATCTCCGGACCCACTTAGGAGAcaagccctttgagtgcacggtctgcaacaagaagttcaccAGAAGTGACAGCCTCAGAGTGCATCTCCGAACTCACACAGGAGAcaagccctttgagtgcacggCCTGCAACAGGAAGTTCATCCATGGTGGCGACCTCAGAGTGCATCTCCGGACCCACACTGGGGACAAGCCCTTTAAGTGCACGgtctgcaacaagaagttctcCAGAAGTGGCAGCCTCAGAAAGCATCTCCGGACCCACACAGGAGAAAGgccctttgagtgcacggtttgcaacaagaagttcatcGAAAGTGGCAAGCTCAGAGTACACCTCCGGACCCACACAGGAGACAAGCCTTTTGAGTGCGCGGTCTGCAATAAGAGGTTCCTCCATGGTGGCAATCTCAGAGTGCATCTCCGGATCCACACAGGAGAcaagccctttgagtgcacggTTTGCAGCAAGAGGTTCTGCCAAAACTctcatctgaaaaagcatctGCGAACCCACACTGAAGGAAACGGTTTGAACATGTAG
Protein Sequence: MGHVCRVCGKKNESASKLVVHLRTHTGEKPFECTVCNKKFSQRSQLKPHLRIHTGEKPFECTVCNKKFNQGGDLRKHLRTHLGDKPFECTVCNKKFTRSDSLRVHLRTHTGDKPFECTACNRKFIHGGDLRVHLRTHTGDKPFKCTVCNKKFSRSGSLRKHLRTHTGERPFECTVCNKKFIESGKLRVHLRTHTGDKPFECAVCNKRFLHGGNLRVHLRIHTGDKPFECTVCSKRFCQNSHLKKHLRTHTEGNGLNM

Sequence clustering based on sequence similarity using MMseqs2