Basic Information

Transcription Factor Domain

TF Family: HMGA
Domain: HMGA domain
PFAM: AnimalTFDB
TF Group: Unclassified Structure
Description: This entry represents the HMGA family, whose members contain DNA-binding domains, also known as AT hooks due to their ability to interact with the narrow minor groove of AT-rich DNA sequences. They play an important role in chromatin organisation [1]. The high mobility group (HMG) proteins are the most abundant and ubiquitous nonhistone chromosomal proteins. They bind to DNA and to nucleosomes and are involved in the regulation of DNA-dependent processes such as transcription, replication, recombination, and DNA repair. They can be grouped into three families: HMGB (HMG 1/2), HMGN (HMG 14/17) and HMGA (HMG I/Y). The characteristic domains are: AT-hook for the HMGA family, the HMG Box for the HMGB family, and the nucleosome-binding domain (NBD) for the members of the HMGN family [2].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0066 1.9e+02 2.5 3.2 11 16 13 18 11 19 0.82

2 5 0.02 6e+02 0.9 0.2 12 15 33 36 32 43 0.87

3 5 3.2e-10 9.3e-06 25.9 3.7 4 22 53 71 51 71 0.89

4 5 0.65 1.9e+04 -3.9 6.9 10 15 83 88 82 89 0.83

5 5 1 2.9e+04 -5.3 1.3 6 9 93 96 92 96 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0066	1.9e+02	2.5	3.2	11	16	13	18	11	19	0.82
2	5	0.02	6e+02	0.9	0.2	12	15	33	36	32	43	0.87
3	5	3.2e-10	9.3e-06	25.9	3.7	4	22	53	71	51	71	0.89
4	5	0.65	1.9e+04	-3.9	6.9	10	15	83	88	82	89	0.83
5	5	1	2.9e+04	-5.3	1.3	6	9	93	96	92	96	0.72

Coding Sequence: ATGTCTGATGACGGATCTACCACAGTCGAGAAAAAAGGACGCGGTAGACCTAAAGCCAATGGAACACAATCTGAGGCCAAAGTCGATACGAAGAAAAGAGGTAGACCACCAGTGGCCTCCAAGACCAAAGAATCGGCAAAGTCATCTGATGATGAACAAGCTCCAGTAGCAAAAAGAGGTCGAGGCAGGCCCAAAGGCTCCAAGAAAAAGTCAGCTGCAAAAGGAAAGaGTGCACCAGTGGAAGGTCGTGGTCGTGGACGACCGCGCAAAGACGCTCCACCACCCAAAAAAGATGCTGCCTCCACTGAAGAGGAACCGGATGAGGAGGATGAGGATGAAGGCTCTGAAGACCAGTAA
Protein Sequence: MSDDGSTTVEKKGRGRPKANGTQSEAKVDTKKRGRPPVASKTKESAKSSDDEQAPVAKRGRGRPKGSKKKSAAKGKSAPVEGRGRGRPRKDAPPPKKDAASTEEEPDEEDEDEGSEDQ*

Sequence clustering based on sequence similarity using MMseqs2