Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.002 31 6.1 0.0 26 52 36 62 29 64 0.89

2 5 3.1e-08 0.00049 21.5 0.1 21 45 65 89 59 93 0.84

3 5 0.00053 8.4 8.0 0.4 21 48 95 122 89 126 0.92

4 5 0.61 9.6e+03 -1.8 0.0 21 43 124 146 120 148 0.65

5 5 1.6 2.5e+04 -3.2 0.2 27 43 158 174 157 181 0.70

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.002	31	6.1	0.0	26	52	36	62	29	64	0.89
2	5	3.1e-08	0.00049	21.5	0.1	21	45	65	89	59	93	0.84
3	5	0.00053	8.4	8.0	0.4	21	48	95	122	89	126	0.92
4	5	0.61	9.6e+03	-1.8	0.0	21	43	124	146	120	148	0.65
5	5	1.6	2.5e+04	-3.2	0.2	27	43	158	174	157	181	0.70

Coding Sequence: ATGCAACGTTTGCGTGAAGCAATGCGGATCAAACCATCGGAATTaTTTCCCAGCAATCGAAAACTCTCATCTCATCTACCCGTTCACAGTACAATATGCACTTCTATGTGCGATATTTGTGgaaatacatttaaaagtaaatttacgCTTAAAAAACACATTGAGTACCAACATTCAGAAAATCCGCGTAAAGACAAAGAACCACAGGAGTGTCCTATTTGTTACAAAGTCCTTAGAGGCAATAAAGGTCTTCGGGcgcatatgaaaaatatacatgACGATGGCGAGCAAGAGCATCGTTGTAAGATCTGTAATCACGTTTCGACAACGGCCAAAGGCCTACGAGTGCATGAGATATTTCGTCATGAAAAAGAAAGGAAACATAAGTGCTCTTTGTGTGGTAAAGCATTTAAGAGACCTTTGgacttaaaaGAACATATTGCTACACACACTGGGATGTCATTGTATAAATGTGCCGAATGTCAAGCAACATTTAAGTCAAACTCAAACTATTATCATCACAGAAGGCGCTTTCATAGTGATAAATCAAAAAGCGAATTAATGATTAGAATAGATGATTGTCCTTAG
Protein Sequence: MQRLREAMRIKPSELFPSNRKLSSHLPVHSTICTSMCDICGNTFKSKFTLKKHIEYQHSENPRKDKEPQECPICYKVLRGNKGLRAHMKNIHDDGEQEHRCKICNHVSTTAKGLRVHEIFRHEKERKHKCSLCGKAFKRPLDLKEHIATHTGMSLYKCAECQATFKSNSNYYHHRRRFHSDKSKSELMIRIDDCP*

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00331853;
90% Identity: iTF_00200230; iTF_01138479; iTF_01397910; iTF_00259259; iTF_00200413;
80% Identity: iTF_01397910;