Basic Information

Transcription Factor Domain

TF Family: zf-GAGA
Domain: zf-GAGA domain
PFAM: PF09237
TF Group: Zinc-Coordinating Group
Description: Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0069 38 5.4 0.0 27 52 2 27 1 29 0.91

2 5 3.3e-08 0.00018 22.4 0.1 21 46 30 55 24 61 0.84

3 5 0.004 22 6.1 0.4 23 48 62 87 55 91 0.89

4 5 0.71 3.9e+03 -1.1 0.1 21 43 89 111 85 114 0.68

5 5 0.89 4.8e+03 -1.4 0.3 27 44 123 140 121 148 0.76

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0069	38	5.4	0.0	27	52	2	27	1	29	0.91
2	5	3.3e-08	0.00018	22.4	0.1	21	46	30	55	24	61	0.84
3	5	0.004	22	6.1	0.4	23	48	62	87	55	91	0.89
4	5	0.71	3.9e+03	-1.1	0.1	21	43	89	111	85	114	0.68
5	5	0.89	4.8e+03	-1.4	0.3	27	44	123	140	121	148	0.76

Coding Sequence: ATGTGCGATATTTGCggcaatacatttaaaaataaatttactctcAAAAAGCACATTGAATATAATCATTCGGAGAACCCACGTAAGGATAAAGAACCCCAACAATGTCCCATCTGTTATAAGGTGCTGAGAGGCAACAAGGGTCTTAGAGCGCACATGAAGAACATACATGATGACAATACACAGGAGCATCGTTGTAAAATTTGTAATCACGTATCAACAACGGCGAAGGGCTTACGAGTTCACGAGATATTCCGACATGAAAAGGAGCGTAAACACAAGTGTTCGTTGTGTGATAAGGCCTTCAAGAGGCCTTTGGATTTGAAAgaGCATATTGCTACTCATACCGGCATGTCTTTGTATAAATGTGCGGAATGTCATGCTACGTTTAAATCAAACTCGAATTATTATCATCATAGAAGACGTTTTCATAGTGGAAAATCAAAAACGGAATTAATGATTAAAATAGACGATTGTCCCTAA
Protein Sequence: MCDICGNTFKNKFTLKKHIEYNHSENPRKDKEPQQCPICYKVLRGNKGLRAHMKNIHDDNTQEHRCKICNHVSTTAKGLRVHEIFRHEKERKHKCSLCDKAFKRPLDLKEHIATHTGMSLYKCAECHATFKSNSNYYHHRRRFHSGKSKTELMIKIDDCP

Sequence clustering based on sequence similarity using MMseqs2