Bbay027618.1
Basic Information
- Insect
- Bellardia bayeri
- Gene Symbol
- ZNF574_2
- Assembly
- GCA_950370525.1
- Location
- OX493268.1:73720619-73721167[-]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 5 0.0069 38 5.4 0.0 27 52 2 27 1 29 0.91 2 5 3.3e-08 0.00018 22.4 0.1 21 46 30 55 24 61 0.84 3 5 0.004 22 6.1 0.4 23 48 62 87 55 91 0.89 4 5 0.71 3.9e+03 -1.1 0.1 21 43 89 111 85 114 0.68 5 5 0.89 4.8e+03 -1.4 0.3 27 44 123 140 121 148 0.76
Sequence Information
- Coding Sequence
- ATGTGCGATATTTGCggcaatacatttaaaaataaatttactctcAAAAAGCACATTGAATATAATCATTCGGAGAACCCACGTAAGGATAAAGAACCCCAACAATGTCCCATCTGTTATAAGGTGCTGAGAGGCAACAAGGGTCTTAGAGCGCACATGAAGAACATACATGATGACAATACACAGGAGCATCGTTGTAAAATTTGTAATCACGTATCAACAACGGCGAAGGGCTTACGAGTTCACGAGATATTCCGACATGAAAAGGAGCGTAAACACAAGTGTTCGTTGTGTGATAAGGCCTTCAAGAGGCCTTTGGATTTGAAAgaGCATATTGCTACTCATACCGGCATGTCTTTGTATAAATGTGCGGAATGTCATGCTACGTTTAAATCAAACTCGAATTATTATCATCATAGAAGACGTTTTCATAGTGGAAAATCAAAAACGGAATTAATGATTAAAATAGACGATTGTCCCTAA
- Protein Sequence
- MCDICGNTFKNKFTLKKHIEYNHSENPRKDKEPQQCPICYKVLRGNKGLRAHMKNIHDDNTQEHRCKICNHVSTTAKGLRVHEIFRHEKERKHKCSLCDKAFKRPLDLKEHIATHTGMSLYKCAECHATFKSNSNYYHHRRRFHSGKSKTELMIKIDDCP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00331853;
- 90% Identity
- iTF_01398093;
- 80% Identity
- iTF_00200230;