Smyo015476.1
Basic Information
- Insect
- Synanthedon myopaeformis
- Gene Symbol
- -
- Assembly
- GCA_944738625.1
- Location
- CALYFO010001051.1:54033-54575[+]
Transcription Factor Domain
- TF Family
- zf-GAGA
- Domain
- zf-GAGA domain
- PFAM
- PF09237
- TF Group
- Zinc-Coordinating Group
- Description
- Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 6 0.00059 3 8.2 0.0 24 45 9 30 3 34 0.87 2 6 0.00057 2.9 8.3 0.1 24 45 37 58 30 61 0.86 3 6 0.00036 1.8 8.9 0.1 24 48 65 89 57 94 0.85 4 6 0.014 74 3.8 0.0 24 48 94 118 86 124 0.85 5 6 0.00044 2.2 8.6 0.1 24 45 123 144 115 147 0.84 6 6 0.00079 4.1 7.8 0.1 24 44 151 171 144 176 0.87
Sequence Information
- Coding Sequence
- ATGTCTGTACATTCGGACCTTCCACCCACTCATTGCGACATTTGCAAGAAAACATTTAAATACAAACATAATTTAAGCAGGCACATGTCTGTACATTCGGACCTTCCACCCACTCATTGCGACATTTGCAAGAAAACATTTAAATACAAACATAATTTAAGCAGGCACATGTCTGTACATTCGGACCTTCCACCCACTCACTGCGACATTTGCAAGAAGACATTTAAATACAAAGAGAGTTTAAGGAGGCACATATCGGCTGTACATTCGGACCTTCCACCCTTTCAGTGCGACATTTGCAAGAAGACATTTAAATACAAAGAGAGTTTAAGCAGGCACATATCGTCTGTACATTCGGACCTTCCACCCACTCAGTGCGACATTTGCAAAAAGACATTTAAATATAAACATAATTTAAGCAGGCACATGTCTGTACATTCGGACCTTCCACCCACTCATTGCGACATTTGCAAGAAAACATTTAAATACAAACATAATTTAAGCAGGCACATGTCTGCACATTCGGACCTTCCACCCACTTAG
- Protein Sequence
- MSVHSDLPPTHCDICKKTFKYKHNLSRHMSVHSDLPPTHCDICKKTFKYKHNLSRHMSVHSDLPPTHCDICKKTFKYKESLRRHISAVHSDLPPFQCDICKKTFKYKESLSRHISSVHSDLPPTQCDICKKTFKYKHNLSRHMSVHSDLPPTHCDICKKTFKYKHNLSRHMSAHSDLPPT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01388130;
- 90% Identity
- iTF_01388130;
- 80% Identity
- iTF_01388130;