Basic Information

Gene Symbol
-
Assembly
GCA_944738625.1
Location
CALYFO010001051.1:52179-52721[+]

Transcription Factor Domain

TF Family
zf-GAGA
Domain
zf-GAGA domain
PFAM
PF09237
TF Group
Zinc-Coordinating Group
Description
Members of this family bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 6 0.00059 3 8.2 0.0 24 45 9 30 3 34 0.87
2 6 0.00057 2.9 8.3 0.1 24 45 37 58 30 61 0.86
3 6 0.00036 1.8 8.9 0.1 24 48 65 89 57 94 0.85
4 6 0.014 74 3.8 0.0 24 48 94 118 86 124 0.85
5 6 0.00044 2.2 8.6 0.1 24 45 123 144 115 147 0.84
6 6 0.00079 4.1 7.8 0.1 24 44 151 171 144 176 0.87

Sequence Information

Coding Sequence
ATGTCTGTACATTCGGACCTTCCACCCACTCATTGCGACATTTGCAAGAAAACATTTAAATACAAACATAATTTAAGCAGGCACATGTCTGTACATTCGGACCTTCCACCCACTCATTGCGACATTTGCAAGAAAACATTTAAATACAAACATAATTTAAGCAGGCACATGTCTGTACATTCGGACCTTCCACCCACTCACTGCGACATTTGCAAGAAGACATTTAAATACAAAGAGAGTTTAAGGAGGCACATATCGGCTGTACATTCGGACCTTCCACCCTTTCAGTGCGACATTTGCAAGAAGACATTTAAATACAAAGAGAGTTTAAGCAGGCACATATCGTCTGTACATTCGGACCTTCCACCCACTCAGTGCGACATTTGCAAAAAGACATTTAAATATAAACATAATTTAAGCAGGCACATGTCTGTACATTCGGACCTTCCACCCACTCATTGCGACATTTGCAAGAAAACATTTAAATACAAACATAATTTAAGCAGGCACATGTCTGCACATTCGGACCTTCCACCCACTTAG
Protein Sequence
MSVHSDLPPTHCDICKKTFKYKHNLSRHMSVHSDLPPTHCDICKKTFKYKHNLSRHMSVHSDLPPTHCDICKKTFKYKESLRRHISAVHSDLPPFQCDICKKTFKYKESLSRHISSVHSDLPPTQCDICKKTFKYKHNLSRHMSVHSDLPPTHCDICKKTFKYKHNLSRHMSAHSDLPPT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2